SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216895.VV1_1627 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216895.VV1_1627
Domain Number 1 Region: 130-294
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.67e-60
Family NadC C-terminal domain-like 0.00000079
Further Details:      
 
Domain Number 2 Region: 13-128
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.3e-33
Family NadC N-terminal domain-like 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216895.VV1_1627
Sequence length 295
Comment (Vibrio vulnificus CMCP6)
Sequence
MKNTHNSQERLDYLKQQLPIEITRAVTDTLKEDLGGSLNADNDVTAALIPAEAINTATII
TREHGVFCGQAWADEVFKQLGGKVTIEWHVKDGDKVEPNQTLCTLIGPARDLLTGERNAM
NFIQTLSGCATITAQYAAKIAHTECRLLDTRKTIPGLRSALKYAVACGGGYNHRIGVFDA
YLIKENHIIACGGITQAVTKAKELQPGKPVEVETENLDELREAINAGADIIMLDNFTTEM
MRQAVEINAGRAALENSGNVTLETIAEYAETGVDYISVGALTKHVKAMDLSMRFK
Download sequence
Identical sequences gi|27364991|ref|NP_760519.1| 216895.VV1_1627 WP_011079552.1.17874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]