SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216895.VV1_1708 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216895.VV1_1708
Domain Number 1 Region: 5-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.27e-48
Family Ribonuclease PH domain 1-like 0.0000163
Further Details:      
 
Domain Number 2 Region: 293-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-46
Family Ribonuclease PH domain 1-like 0.0000207
Further Details:      
 
Domain Number 3 Region: 146-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.23e-28
Family Ribonuclease PH domain 2-like 0.00095
Further Details:      
 
Domain Number 4 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.95e-27
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 608-695
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-22
Family Cold shock DNA-binding domain-like 0.0000804
Further Details:      
 
Domain Number 6 Region: 555-623
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000114
Family Eukaryotic type KH-domain (KH-domain type I) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216895.VV1_1708
Sequence length 708
Comment (Vibrio vulnificus CMCP6)
Sequence
MFEKPVVKTFQYGNHTVTLETGVIARQATAAVMVTMDDTAVFVSVVGKKEAVPGQDFFPL
TVNYQERTYAAGKIPGGFFKREGRPSEGETLTARLIDRPIRPLFPEGFNNEVQVIATVVS
VNPDVQPDIPTMIGTSAALAISGIPFNGPIGAARVGHIDGQLVLNPSNTELNASRLDLVV
AGTESAVLMVESEADNLTEEEMLSAVVFGHDQQQAVIKAINEFAAEVATPSWNWVAPEAN
TALNEKVADLAEAKLVEAYKITEKMARYDRIHEIAAEVNAVILAEDPEADAKEIHTIFHD
LEKTVVRRSIIAGNPRIDGREKDMVRALDVRTGVLPRTHGSSLFTRGETQALVTATLGTQ
RDAQIIDELTGEKKDYFLLHYNFPPYCVGETGFVGSPKRREIGHGKLAKRGIAAVMPSID
EFPYTVRVVSEITESNGSSSMASVCGTSLALMDAGVPIKASVAGIAMGLVKEGDDFVVLS
DILGDEDHLGDMDFKVAGTSTGITALQMDIKIEGITKEIMQIALNQAQGARKHILSVMDQ
AISGARDDISEFAPRIHTMKISADKIKDVIGKGGAVIRALTEETGTTIEIEDDGTIKIAA
TEGAAAKEAIRRIQEITAEVEVGVIYTGKVARLADFGAFVTILPGKDGLVHISQIADKRV
EKVSDYLTEGQEVQVKVLEIDRQGRVRLSMKEAVEKPVEAEAPAAEEE
Download sequence
Identical sequences A0A087J403 A0A0H0Y510 A0A1L9L4S0 Q7MI20 Q8DBU9
WP_011079626.1.100126 WP_011079626.1.13374 WP_011079626.1.17874 WP_011079626.1.21633 WP_011079626.1.22486 WP_011079626.1.22778 WP_011079626.1.24453 WP_011079626.1.25536 WP_011079626.1.28215 WP_011079626.1.28571 WP_011079626.1.30871 WP_011079626.1.31968 WP_011079626.1.33883 WP_011079626.1.34622 WP_011079626.1.39407 WP_011079626.1.39524 WP_011079626.1.43691 WP_011079626.1.47396 WP_011079626.1.49981 WP_011079626.1.512 WP_011079626.1.53345 WP_011079626.1.53782 WP_011079626.1.54486 WP_011079626.1.54603 WP_011079626.1.54858 WP_011079626.1.55006 WP_011079626.1.553 WP_011079626.1.58875 WP_011079626.1.58885 WP_011079626.1.59022 WP_011079626.1.59048 WP_011079626.1.59451 WP_011079626.1.60868 WP_011079626.1.63462 WP_011079626.1.63825 WP_011079626.1.65015 WP_011079626.1.66219 WP_011079626.1.66581 WP_011079626.1.67868 WP_011079626.1.73066 WP_011079626.1.73173 WP_011079626.1.78369 WP_011079626.1.78668 WP_011079626.1.79678 WP_011079626.1.81060 WP_011079626.1.81460 WP_011079626.1.82587 WP_011079626.1.8292 WP_011079626.1.8379 WP_011079626.1.84562 WP_011079626.1.86005 WP_011079626.1.86748 WP_011079626.1.89979 WP_011079626.1.90288 WP_011079626.1.93668 WP_011079626.1.94371 WP_011079626.1.95941 WP_011079626.1.96968 WP_011079626.1.9921 WP_011079626.1.99976 gi|320155451|ref|YP_004187830.1| 216895.VV1_1708 gi|27365068|ref|NP_760596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]