SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218491.ECA0716 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218491.ECA0716
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.01e-50
Family Ribonuclease PH domain 1-like 0.0000141
Further Details:      
 
Domain Number 2 Region: 293-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-47
Family Ribonuclease PH domain 1-like 0.0000148
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.33e-29
Family Ribonuclease PH domain 2-like 0.0011
Further Details:      
 
Domain Number 4 Region: 450-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.55e-28
Family Ribonuclease PH domain 2-like 0.0000769
Further Details:      
 
Domain Number 5 Region: 608-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-22
Family Cold shock DNA-binding domain-like 0.0000258
Further Details:      
 
Domain Number 6 Region: 239-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.12e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.003
Further Details:      
 
Domain Number 7 Region: 552-629
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.07e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 218491.ECA0716
Sequence length 706
Comment (Erwinia carotovora atroseptica SCRI1043)
Sequence
MLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGAKNAKPGQSFFPLT
VNYQERTYAAGRFPGGFFRREGRPSEGETLTSRLIDRPIRPLFPEGFLNEVQVIATVVSV
NPQVSPDIVAMIGASAALSLSGIPFSGPIGVARVGYLNDQYVLNPTTDELKESRLDLVVA
GTQGAVLMVESEAELLSEDQMLGAVVFGHEQQQIVIENINSLVAEAGKPKWEWHAPAVNV
SLEQRVQALSEARLGDAYRITEKQERYAQVNVIKTDVVAALQAEDETLNAGEIQEILGNI
EKNVVRGRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVTATLGTER
DAQNIDELTGERTDRFLLHYNFPPYCVGETGMVGSPKRREIGHGRLAKRGVLAVMPKANE
FPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKSAVAGIAMGLVKEGDNFVVLSD
ILGDEDHLGDMDFKVAGSREGITALQMDIKIEGITREIMQVALNQAKGARLHILGVMEQA
ISTPRGDISEFAPRIHTIKISTDKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVRIAST
DGEKAKHAIRRIEEITAEIEVGRVYQGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVE
KVTDYLQMGQEVPVKVLEVDRQGRVRLSIKEANPQTQEAAAPSSEE
Download sequence
Identical sequences Q6D9A1
WP_011092325.1.79946 218491.ECA0716 gi|50119663|ref|YP_048830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]