SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218491.ECA3359 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218491.ECA3359
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ribosomal protein S16 9.94e-29
Family Ribosomal protein S16 0.0000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 218491.ECA3359
Sequence length 82
Comment (Erwinia carotovora atroseptica SCRI1043)
Sequence
MVTIRLARGGAKKRPFYQVVVTDSRNARDGRFIERVGFFNPIATGQAEALRLDLDRIEHW
LGLGATVSDRVSSLIKDAKKAA
Download sequence
Identical sequences Q6D1T8
218491.ECA3359 gi|50122281|ref|YP_051448.1| WP_011094872.1.17763 WP_011094872.1.32123 WP_011094872.1.57850 WP_011094872.1.77917 WP_011094872.1.79946 WP_011094872.1.80346 WP_011094872.1.94180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]