SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218491.ECA3847 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218491.ECA3847
Domain Number 1 Region: 53-334
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.94e-76
Family alpha-L-arabinanase-like 0.0000195
Further Details:      
 
Domain Number 2 Region: 356-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-18
Family Beta-D-xylosidase C-terminal domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 218491.ECA3847
Sequence length 540
Comment (Erwinia carotovora atroseptica SCRI1043)
Sequence
MSISRTVGKGALSGILLMAMGISQAIACQAGPANEWMRGIEQQRQADLGNGCYLNPIIAG
DHPDPTIIKDGEDYYMTFSSFDDIPGLLIWHSRDLVNWQPLGPAITMPVDAIWAPDLVKH
NDKYYLYFTTNRIIDAKGTKKKTLYVITADDIRGPWTPPKDTGLKNPASDPGHVVGEDGK
RYIFMSGGNRVQLTDDGLSTVGEMEVVYQGWQYPEAWDVESFSQEGPKMLRHGDYFYMVL
AEGGTAGPPTGHMVIAARSKSINGPWENSPYNPIIRTQDRSDKWWSRGHATLIEGPDKNW
YMVYHGYENGFMTLGRQAMLEPIVWGADGWFTSAGFDTGKPIRKPEGGEAVPHGIGWSDS
FTDEKFPARWHFYRANAEELKRVTLTDGKLHLKAKGTSPKDSAPLTMIPGDQAYQIEVTA
NFAPGAQAGLLLFYNAKLYVGLSFNQYGTVMHRYGLERAEKKLPHITGNEVQIRMKNDRH
IVTFYTRTSDQEPWKKYPVQMEVSGYHHNVAYDFLSLRPALYASGEGEVTFSNLRYQALP
Download sequence
Identical sequences Q6D0F2
218491.ECA3847 WP_011095345.1.57850 WP_011095345.1.79946 WP_011095345.1.94180 gi|50122768|ref|YP_051935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]