SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218491.ECA4009 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218491.ECA4009
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.24e-45
Family Ribosomal protein S13 0.00000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 218491.ECA4009
Sequence length 118
Comment (Erwinia carotovora atroseptica SCRI1043)
Sequence
MARIAGINIPDHKHTVIALTSIFGIGKTRSQAICAATEIAENVKISELSEEQIDKLRDEV
AKFVVEGDLRREVTLSIKRLMDLGTYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK
Download sequence
Identical sequences A0A0J5XIY4 A0A2I1BMI6 Q6CZZ2
218491.ECA4009 WP_011095499.1.17763 WP_011095499.1.19434 WP_011095499.1.32123 WP_011095499.1.57850 WP_011095499.1.77917 WP_011095499.1.79946 WP_011095499.1.80346 WP_011095499.1.94180 gi|50122929|ref|YP_052096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]