SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218491.ECA4304 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  218491.ECA4304
Domain Number - Region: 130-209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0343
Family Glycosyl hydrolases family 16 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 218491.ECA4304
Sequence length 230
Comment (Erwinia carotovora atroseptica SCRI1043)
Sequence
MIDPSCTENTLILSPQVNGTRDITDSPHRSALIWSTDSTGQPLQWQVEQEDPDRAAIQTT
PERLTLESAAGLTLWLDAPLSGTYRIAFTREILVADRPYDRVSDLNQFWAARDLHHPNLF
TRHGKLNEYDSLNLYYVGMGGNWNSTTRFRYYDGHGERLLLGEYTDAAHLLRPNHRYRIV
IEVDRRETRFWVDDVLYFHASYPNTPAPGYFGFRTVFSRQEISEFSITPL
Download sequence
Identical sequences Q6CZ49
218491.ECA4304 gi|50123224|ref|YP_052391.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]