SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218494.SSU0294 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218494.SSU0294
Domain Number 1 Region: 9-190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-40
Family Beta-D-xylosidase C-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 218494.SSU0294
Sequence length 204
Comment (Streptococcus suis P1 7)
Sequence
MKEFTVKDLVWTRPPRQFTISDEEITITTHPQTDLWQKTYYHFVNDNAPVLQMETEEDYF
SFTVKTDFAGSHTRFDQCGIVLYQDSENWLKCSIEYENDDFQHLGSVVTNHGFSDWATTE
VSSQIKSMWFRLSRRGADYCFENSEDGIHFKQMRVCHFHQGAGKIAFGLYACSPENSSFT
ARFTNMELSDCKWQAHDGQEPDEI
Download sequence
Identical sequences A0A2K1T2Q8 A4VT44 D5AFZ0
gi|476419281|ref|YP_007570277.1| gi|253751194|ref|YP_003024335.1| WP_011921893.1.10007 WP_011921893.1.100280 WP_011921893.1.100404 WP_011921893.1.100701 WP_011921893.1.100908 WP_011921893.1.101097 WP_011921893.1.101179 WP_011921893.1.101295 WP_011921893.1.101658 WP_011921893.1.101706 WP_011921893.1.102038 WP_011921893.1.10265 WP_011921893.1.1035 WP_011921893.1.10896 WP_011921893.1.11330 WP_011921893.1.11662 WP_011921893.1.11869 WP_011921893.1.11874 WP_011921893.1.1200 WP_011921893.1.12022 WP_011921893.1.12228 WP_011921893.1.12288 WP_011921893.1.12606 WP_011921893.1.12803 WP_011921893.1.1324 WP_011921893.1.13380 WP_011921893.1.13633 WP_011921893.1.13861 WP_011921893.1.1405 WP_011921893.1.14202 WP_011921893.1.1434 WP_011921893.1.14359 WP_011921893.1.1495 WP_011921893.1.15112 WP_011921893.1.1537 WP_011921893.1.15393 WP_011921893.1.15545 WP_011921893.1.15813 WP_011921893.1.16193 WP_011921893.1.1629 WP_011921893.1.16643 WP_011921893.1.16773 WP_011921893.1.17264 WP_011921893.1.17670 WP_011921893.1.17749 WP_011921893.1.17958 WP_011921893.1.18271 WP_011921893.1.18341 WP_011921893.1.18563 WP_011921893.1.18711 WP_011921893.1.18850 WP_011921893.1.19352 WP_011921893.1.19378 WP_011921893.1.1953 WP_011921893.1.19865 WP_011921893.1.20400 WP_011921893.1.20518 WP_011921893.1.20584 WP_011921893.1.20756 WP_011921893.1.20944 WP_011921893.1.21347 WP_011921893.1.21457 WP_011921893.1.22785 WP_011921893.1.22882 WP_011921893.1.23089 WP_011921893.1.23273 WP_011921893.1.24078 WP_011921893.1.24150 WP_011921893.1.24175 WP_011921893.1.24187 WP_011921893.1.24858 WP_011921893.1.24883 WP_011921893.1.25280 WP_011921893.1.25381 WP_011921893.1.25396 WP_011921893.1.25824 WP_011921893.1.25950 WP_011921893.1.26009 WP_011921893.1.26302 WP_011921893.1.26368 WP_011921893.1.27108 WP_011921893.1.27381 WP_011921893.1.27476 WP_011921893.1.27754 WP_011921893.1.27760 WP_011921893.1.27767 WP_011921893.1.28000 WP_011921893.1.28033 WP_011921893.1.28244 WP_011921893.1.28467 WP_011921893.1.28645 WP_011921893.1.28796 WP_011921893.1.28805 WP_011921893.1.29141 WP_011921893.1.29610 WP_011921893.1.30241 WP_011921893.1.30414 WP_011921893.1.31597 WP_011921893.1.31730 WP_011921893.1.32259 WP_011921893.1.32332 WP_011921893.1.32466 WP_011921893.1.32630 WP_011921893.1.33330 WP_011921893.1.34321 WP_011921893.1.34425 WP_011921893.1.34527 WP_011921893.1.34738 WP_011921893.1.35430 WP_011921893.1.35551 WP_011921893.1.35675 WP_011921893.1.36136 WP_011921893.1.36766 WP_011921893.1.37126 WP_011921893.1.37237 WP_011921893.1.37841 WP_011921893.1.38409 WP_011921893.1.38470 WP_011921893.1.39011 WP_011921893.1.39023 WP_011921893.1.39247 WP_011921893.1.39280 WP_011921893.1.39714 WP_011921893.1.3989 WP_011921893.1.40062 WP_011921893.1.40141 WP_011921893.1.40228 WP_011921893.1.40384 WP_011921893.1.40507 WP_011921893.1.40669 WP_011921893.1.4074 WP_011921893.1.41046 WP_011921893.1.41112 WP_011921893.1.41280 WP_011921893.1.42323 WP_011921893.1.42552 WP_011921893.1.42596 WP_011921893.1.42732 WP_011921893.1.4278 WP_011921893.1.42784 WP_011921893.1.42840 WP_011921893.1.43264 WP_011921893.1.43288 WP_011921893.1.43482 WP_011921893.1.43813 WP_011921893.1.43922 WP_011921893.1.43963 WP_011921893.1.43977 WP_011921893.1.44047 WP_011921893.1.44128 WP_011921893.1.44676 WP_011921893.1.44778 WP_011921893.1.45088 WP_011921893.1.45216 WP_011921893.1.45219 WP_011921893.1.45278 WP_011921893.1.45864 WP_011921893.1.45936 WP_011921893.1.467 WP_011921893.1.46880 WP_011921893.1.47315 WP_011921893.1.47434 WP_011921893.1.4748 WP_011921893.1.4757 WP_011921893.1.47643 WP_011921893.1.47894 WP_011921893.1.47900 WP_011921893.1.48167 WP_011921893.1.48217 WP_011921893.1.48397 WP_011921893.1.48603 WP_011921893.1.49206 WP_011921893.1.49255 WP_011921893.1.49368 WP_011921893.1.49509 WP_011921893.1.49782 WP_011921893.1.49968 WP_011921893.1.50047 WP_011921893.1.5021 WP_011921893.1.50437 WP_011921893.1.50538 WP_011921893.1.50551 WP_011921893.1.50675 WP_011921893.1.50751 WP_011921893.1.5079 WP_011921893.1.50798 WP_011921893.1.51263 WP_011921893.1.51551 WP_011921893.1.52159 WP_011921893.1.52599 WP_011921893.1.52628 WP_011921893.1.52798 WP_011921893.1.53174 WP_011921893.1.53309 WP_011921893.1.534 WP_011921893.1.53448 WP_011921893.1.53487 WP_011921893.1.53805 WP_011921893.1.54000 WP_011921893.1.5404 WP_011921893.1.54184 WP_011921893.1.54488 WP_011921893.1.54828 WP_011921893.1.55137 WP_011921893.1.55158 WP_011921893.1.55649 WP_011921893.1.55687 WP_011921893.1.5579 WP_011921893.1.55833 WP_011921893.1.55834 WP_011921893.1.56215 WP_011921893.1.56463 WP_011921893.1.57067 WP_011921893.1.5714 WP_011921893.1.5754 WP_011921893.1.57640 WP_011921893.1.57674 WP_011921893.1.57810 WP_011921893.1.58229 WP_011921893.1.58517 WP_011921893.1.58566 WP_011921893.1.58706 WP_011921893.1.58746 WP_011921893.1.58793 WP_011921893.1.58903 WP_011921893.1.59071 WP_011921893.1.59144 WP_011921893.1.59283 WP_011921893.1.59349 WP_011921893.1.5936 WP_011921893.1.59524 WP_011921893.1.5974 WP_011921893.1.60237 WP_011921893.1.60445 WP_011921893.1.60658 WP_011921893.1.60853 WP_011921893.1.609 WP_011921893.1.61533 WP_011921893.1.61540 WP_011921893.1.6165 WP_011921893.1.61782 WP_011921893.1.6223 WP_011921893.1.62485 WP_011921893.1.6278 WP_011921893.1.62805 WP_011921893.1.63318 WP_011921893.1.63685 WP_011921893.1.63959 WP_011921893.1.64128 WP_011921893.1.64273 WP_011921893.1.64281 WP_011921893.1.64384 WP_011921893.1.64641 WP_011921893.1.64797 WP_011921893.1.64952 WP_011921893.1.65024 WP_011921893.1.65047 WP_011921893.1.65422 WP_011921893.1.65458 WP_011921893.1.65905 WP_011921893.1.65911 WP_011921893.1.65917 WP_011921893.1.6596 WP_011921893.1.66590 WP_011921893.1.66954 WP_011921893.1.67058 WP_011921893.1.67109 WP_011921893.1.6711 WP_011921893.1.67488 WP_011921893.1.677 WP_011921893.1.67958 WP_011921893.1.67962 WP_011921893.1.68010 WP_011921893.1.68303 WP_011921893.1.68602 WP_011921893.1.68666 WP_011921893.1.68791 WP_011921893.1.69115 WP_011921893.1.69161 WP_011921893.1.69413 WP_011921893.1.69454 WP_011921893.1.69706 WP_011921893.1.69922 WP_011921893.1.70387 WP_011921893.1.70997 WP_011921893.1.71125 WP_011921893.1.71140 WP_011921893.1.71425 WP_011921893.1.71727 WP_011921893.1.72247 WP_011921893.1.72296 WP_011921893.1.72413 WP_011921893.1.7257 WP_011921893.1.73011 WP_011921893.1.73262 WP_011921893.1.73280 WP_011921893.1.73299 WP_011921893.1.73679 WP_011921893.1.73721 WP_011921893.1.73905 WP_011921893.1.74567 WP_011921893.1.74865 WP_011921893.1.75028 WP_011921893.1.75605 WP_011921893.1.75985 WP_011921893.1.76083 WP_011921893.1.76175 WP_011921893.1.76400 WP_011921893.1.76735 WP_011921893.1.76907 WP_011921893.1.77006 WP_011921893.1.77616 WP_011921893.1.77624 WP_011921893.1.77781 WP_011921893.1.77795 WP_011921893.1.77958 WP_011921893.1.78326 WP_011921893.1.7873 WP_011921893.1.78945 WP_011921893.1.79054 WP_011921893.1.79162 WP_011921893.1.80097 WP_011921893.1.80131 WP_011921893.1.80153 WP_011921893.1.80216 WP_011921893.1.80418 WP_011921893.1.8061 WP_011921893.1.80716 WP_011921893.1.80742 WP_011921893.1.81103 WP_011921893.1.81370 WP_011921893.1.81513 WP_011921893.1.81584 WP_011921893.1.81705 WP_011921893.1.8251 WP_011921893.1.82830 WP_011921893.1.82977 WP_011921893.1.83818 WP_011921893.1.83915 WP_011921893.1.84389 WP_011921893.1.8451 WP_011921893.1.85075 WP_011921893.1.85437 WP_011921893.1.85908 WP_011921893.1.86151 WP_011921893.1.86177 WP_011921893.1.86817 WP_011921893.1.86836 WP_011921893.1.87044 WP_011921893.1.87819 WP_011921893.1.87885 WP_011921893.1.8790 WP_011921893.1.88543 WP_011921893.1.88575 WP_011921893.1.88653 WP_011921893.1.88779 WP_011921893.1.89037 WP_011921893.1.89038 WP_011921893.1.89056 WP_011921893.1.89156 WP_011921893.1.89279 WP_011921893.1.89358 WP_011921893.1.89388 WP_011921893.1.89800 WP_011921893.1.8993 WP_011921893.1.89989 WP_011921893.1.90172 WP_011921893.1.90742 WP_011921893.1.90961 WP_011921893.1.91238 WP_011921893.1.91636 WP_011921893.1.91865 WP_011921893.1.91912 WP_011921893.1.91973 WP_011921893.1.91983 WP_011921893.1.92134 WP_011921893.1.92441 WP_011921893.1.92554 WP_011921893.1.92692 WP_011921893.1.92722 WP_011921893.1.93190 WP_011921893.1.93519 WP_011921893.1.93627 WP_011921893.1.9376 WP_011921893.1.94332 WP_011921893.1.94338 WP_011921893.1.94418 WP_011921893.1.94449 WP_011921893.1.9454 WP_011921893.1.94639 WP_011921893.1.94786 WP_011921893.1.95213 WP_011921893.1.95214 WP_011921893.1.95262 WP_011921893.1.95542 WP_011921893.1.95798 WP_011921893.1.96164 WP_011921893.1.96282 WP_011921893.1.9652 WP_011921893.1.96524 WP_011921893.1.96574 WP_011921893.1.96700 WP_011921893.1.97052 WP_011921893.1.97453 WP_011921893.1.97493 WP_011921893.1.97554 WP_011921893.1.97857 WP_011921893.1.9809 WP_011921893.1.9815 WP_011921893.1.98253 WP_011921893.1.98271 WP_011921893.1.98326 WP_011921893.1.98343 WP_011921893.1.98416 WP_011921893.1.98860 WP_011921893.1.98864 WP_011921893.1.98921 WP_011921893.1.99127 WP_011921893.1.9922 WP_011921893.1.99252 WP_011921893.1.99324 WP_011921893.1.99696 WP_011921893.1.99988 gi|146317972|ref|YP_001197683.1| gi|386579271|ref|YP_006075676.1| 218494.SSU0294 391295.SSU05_0315 391296.SSU98_0311 568813.SSUSC84_0283 gi|253753095|ref|YP_003026235.1| gi|386587567|ref|YP_006083968.1| gi|386577292|ref|YP_006073697.1| gi|403060978|ref|YP_006649194.1| gi|146320159|ref|YP_001199869.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]