SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218494.SSU0587 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218494.SSU0587
Domain Number 1 Region: 907-1229
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.32e-64
Family beta-N-acetylhexosaminidase catalytic domain 0.00049
Further Details:      
 
Domain Number 2 Region: 423-682
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-60
Family Glycosyl hydrolases family 16 0.0022
Further Details:      
 
Domain Number 3 Region: 300-415
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000177
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.092
Further Details:      
 
Domain Number 4 Region: 152-242
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000022
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.059
Further Details:      
 
Weak hits

Sequence:  218494.SSU0587
Domain Number - Region: 1252-1322
Classification Level Classification E-value
Superfamily Translin 0.0222
Family Translin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 218494.SSU0587
Sequence length 1419
Comment (Streptococcus suis P1 7)
Sequence
MKKETSKFTKKVILGQLLICTSFLVWAGQTVAAEEVSQGEPVAINNETPPVIEAKPLVEA
TPSTETEPSTPEEKQEEPQVAGKNVVEGKKPVTNSQHQMVSELSTVPSVSIKNPDAATDG
SAYGSSDDANSNTKIIAGKETGEPDNGYSKWDHVYVQYDFEKEVPVHTVKIHRNTYDNAV
STFKDVKVELSTSADFSPETTEVIFKQADVEETIANKGQPQVIQLPAPINARYIRIWGRG
HYIQNTNSSWKGYSNGVLFNEIEVLAQVEADAGTNEEPQTELVNLAKLKKPYFYGKAPTN
PEAINDGKFDENYTTQESIGDKAYLQYEFRNVYTIEEIKVQLAPGEYRNFRIDLDDDYND
GNNYNTIYKNENFTIDKEQIITIKTPKNSKARYVRFRGTRVDDTPLRYSEIQIMGRGKSY
DESAPEYVPPKSEYDTLVWSDEFNGDKIDESKWQIIDGMWNHAAIYNRKAVSIKKDGDKS
YLSIRSTNHKDKKTLVEAVGHDRYDDKELPDKVTWSSGRLESKDKYSFQFGRMAVRAKVN
DSKGIWPAIWMLAQDETGHDEIDVLEYLGQNPWYAWTTNHFGILAKNKKSDGSAYKNYEA
WSQEFHVYEVEWTPDVIKWYIDGKFVFQTDRGKDRDGMHTRPMFPILETQVGDGWVGDVD
YKRNMTKQDSEYLVDWVRIYQKADQSKVRFDNLDDAKPNDYVIKPQQKLGHLVTVSNGKA
AHENKNNFYYGGQPRYETSRLYADGDGENALVYKIANPEALHLTTYYKTLEDYSVYNKEA
GANEGKSVRKHLINAKDGEIDFTVYSSVDGKSWNKENVTVVDNFVEATPAYARTTFDIRN
IRKGTKFVKIVFPTVKGISYKLEDGTEKGLQASDVQLAKVTFVATHPEAEPEKPIVDQEK
LALSKVFSLDAGRKYFSVNQIKEIIDLISSYGYTDMNLLLGNDGLRFLLDDMNLTVGDKV
YDSEAVRKAIINGNKHYYDDPNGTTLSQSEMDDILAYAKEKNISIIPTINSPGHMDAIVE
AMEELGIKSPKFSYNGKTSARTVDLKNDQAVAFTKALIDKYASYFAGKSKIFNIGLDEYA
NDATNASGWHILQTQGDYGKFIQYANDLAAIVKKHGLEPMAFNDGIYYNHDTSSGTFDKD
IIASFWTGGWGGYDVASSKFLHEKGHKILNTNDAWYYVIGREAEGLGWYNLDQGLRGTKS
TRFDQVPKSENTKVPIIGSMVAVWADDPSKPYSYDSIKKLLHSFTENNSDYFLAEYRDLR
EEVGKIPTDLNSYTPESVATLKEVLNKIDWKLSRNNQAFVDGYLAEVKAAREALVPVTAK
GDSVKAEPLPEGKLPLITAKGKSVQAEPRPAFKGYLTSNYGPSVTPLSLVSKPSSEQSNS
KQAASQKKELPNTGVVDGLGFSLLGMIGLAFASRRRKKE
Download sequence
Identical sequences A0A0H3MVU2 A4VU07 D5AGW5 Q3C168
gi|253751449|ref|YP_003024590.1| gi|403061255|ref|YP_006649471.1| gi|386581621|ref|YP_006078025.1| gi|386579674|ref|YP_006076079.1| 218494.SSU0587 391295.SSU05_0630 568813.SSUSC84_0561 568814.SSUBM407_1236 gi|386587854|ref|YP_006084255.1| gi|476419652|ref|YP_007570648.1| gi|386577616|ref|YP_006074022.1| gi|146318284|ref|YP_001197996.1| gi|253755821|ref|YP_003028961.1| gi|253753350|ref|YP_003026491.1| WP_011922168.1.100404 WP_011922168.1.100701 WP_011922168.1.100908 WP_011922168.1.101097 WP_011922168.1.101179 WP_011922168.1.101295 WP_011922168.1.101621 WP_011922168.1.101658 WP_011922168.1.101706 WP_011922168.1.102038 WP_011922168.1.10265 WP_011922168.1.10896 WP_011922168.1.11017 WP_011922168.1.11330 WP_011922168.1.11662 WP_011922168.1.1200 WP_011922168.1.12022 WP_011922168.1.12228 WP_011922168.1.1244 WP_011922168.1.12606 WP_011922168.1.12803 WP_011922168.1.13095 WP_011922168.1.1324 WP_011922168.1.13380 WP_011922168.1.13861 WP_011922168.1.1405 WP_011922168.1.14202 WP_011922168.1.1434 WP_011922168.1.14359 WP_011922168.1.1495 WP_011922168.1.1537 WP_011922168.1.15393 WP_011922168.1.15545 WP_011922168.1.15756 WP_011922168.1.16193 WP_011922168.1.16498 WP_011922168.1.16643 WP_011922168.1.16683 WP_011922168.1.16773 WP_011922168.1.16829 WP_011922168.1.16881 WP_011922168.1.17264 WP_011922168.1.17670 WP_011922168.1.17814 WP_011922168.1.17958 WP_011922168.1.18341 WP_011922168.1.18403 WP_011922168.1.18563 WP_011922168.1.18850 WP_011922168.1.1953 WP_011922168.1.19865 WP_011922168.1.19898 WP_011922168.1.20518 WP_011922168.1.20584 WP_011922168.1.20756 WP_011922168.1.20944 WP_011922168.1.21457 WP_011922168.1.21903 WP_011922168.1.22785 WP_011922168.1.22882 WP_011922168.1.23089 WP_011922168.1.23273 WP_011922168.1.23317 WP_011922168.1.23965 WP_011922168.1.24078 WP_011922168.1.24150 WP_011922168.1.24175 WP_011922168.1.24187 WP_011922168.1.24431 WP_011922168.1.24858 WP_011922168.1.24883 WP_011922168.1.25245 WP_011922168.1.25280 WP_011922168.1.25381 WP_011922168.1.25396 WP_011922168.1.25617 WP_011922168.1.25711 WP_011922168.1.26009 WP_011922168.1.26302 WP_011922168.1.26368 WP_011922168.1.26620 WP_011922168.1.27108 WP_011922168.1.27225 WP_011922168.1.27227 WP_011922168.1.27381 WP_011922168.1.27476 WP_011922168.1.27695 WP_011922168.1.27760 WP_011922168.1.27767 WP_011922168.1.28033 WP_011922168.1.28244 WP_011922168.1.28467 WP_011922168.1.28796 WP_011922168.1.28805 WP_011922168.1.29141 WP_011922168.1.30079 WP_011922168.1.30241 WP_011922168.1.30414 WP_011922168.1.31597 WP_011922168.1.32259 WP_011922168.1.32332 WP_011922168.1.32466 WP_011922168.1.33330 WP_011922168.1.34321 WP_011922168.1.34425 WP_011922168.1.34652 WP_011922168.1.34738 WP_011922168.1.35551 WP_011922168.1.35675 WP_011922168.1.35725 WP_011922168.1.36136 WP_011922168.1.36251 WP_011922168.1.36611 WP_011922168.1.36766 WP_011922168.1.37237 WP_011922168.1.37653 WP_011922168.1.37688 WP_011922168.1.37816 WP_011922168.1.37841 WP_011922168.1.37915 WP_011922168.1.38409 WP_011922168.1.38470 WP_011922168.1.39011 WP_011922168.1.39023 WP_011922168.1.39247 WP_011922168.1.39280 WP_011922168.1.3989 WP_011922168.1.40062 WP_011922168.1.40141 WP_011922168.1.40228 WP_011922168.1.40384 WP_011922168.1.40507 WP_011922168.1.4074 WP_011922168.1.40802 WP_011922168.1.41046 WP_011922168.1.41112 WP_011922168.1.41280 WP_011922168.1.41854 WP_011922168.1.42323 WP_011922168.1.42552 WP_011922168.1.4278 WP_011922168.1.42827 WP_011922168.1.42840 WP_011922168.1.4291 WP_011922168.1.43288 WP_011922168.1.43482 WP_011922168.1.43813 WP_011922168.1.43922 WP_011922168.1.43963 WP_011922168.1.43977 WP_011922168.1.44592 WP_011922168.1.44778 WP_011922168.1.45088 WP_011922168.1.45216 WP_011922168.1.45219 WP_011922168.1.45345 WP_011922168.1.45864 WP_011922168.1.45936 WP_011922168.1.46880 WP_011922168.1.47315 WP_011922168.1.47375 WP_011922168.1.47434 WP_011922168.1.4757 WP_011922168.1.47643 WP_011922168.1.47745 WP_011922168.1.47894 WP_011922168.1.48167 WP_011922168.1.48397 WP_011922168.1.49099 WP_011922168.1.49206 WP_011922168.1.49255 WP_011922168.1.49368 WP_011922168.1.49413 WP_011922168.1.49509 WP_011922168.1.49782 WP_011922168.1.49968 WP_011922168.1.50047 WP_011922168.1.5021 WP_011922168.1.50437 WP_011922168.1.50538 WP_011922168.1.50751 WP_011922168.1.50798 WP_011922168.1.51263 WP_011922168.1.51386 WP_011922168.1.51551 WP_011922168.1.52159 WP_011922168.1.52599 WP_011922168.1.52628 WP_011922168.1.52798 WP_011922168.1.53174 WP_011922168.1.53290 WP_011922168.1.53309 WP_011922168.1.53448 WP_011922168.1.53487 WP_011922168.1.53749 WP_011922168.1.53805 WP_011922168.1.54000 WP_011922168.1.5404 WP_011922168.1.54184 WP_011922168.1.54384 WP_011922168.1.54488 WP_011922168.1.54800 WP_011922168.1.55158 WP_011922168.1.55649 WP_011922168.1.5579 WP_011922168.1.55815 WP_011922168.1.55833 WP_011922168.1.55834 WP_011922168.1.56140 WP_011922168.1.56215 WP_011922168.1.56434 WP_011922168.1.5714 WP_011922168.1.57640 WP_011922168.1.57674 WP_011922168.1.57810 WP_011922168.1.58229 WP_011922168.1.58517 WP_011922168.1.58585 WP_011922168.1.58706 WP_011922168.1.58746 WP_011922168.1.58793 WP_011922168.1.58815 WP_011922168.1.58903 WP_011922168.1.59071 WP_011922168.1.59138 WP_011922168.1.59144 WP_011922168.1.59349 WP_011922168.1.59524 WP_011922168.1.59647 WP_011922168.1.5974 WP_011922168.1.60237 WP_011922168.1.60293 WP_011922168.1.60445 WP_011922168.1.60659 WP_011922168.1.60853 WP_011922168.1.61370 WP_011922168.1.61540 WP_011922168.1.6165 WP_011922168.1.61782 WP_011922168.1.62268 WP_011922168.1.62485 WP_011922168.1.6278 WP_011922168.1.63318 WP_011922168.1.63653 WP_011922168.1.63685 WP_011922168.1.63959 WP_011922168.1.64128 WP_011922168.1.64273 WP_011922168.1.64281 WP_011922168.1.64384 WP_011922168.1.64797 WP_011922168.1.64952 WP_011922168.1.65024 WP_011922168.1.65047 WP_011922168.1.65174 WP_011922168.1.65314 WP_011922168.1.65422 WP_011922168.1.65458 WP_011922168.1.65905 WP_011922168.1.65917 WP_011922168.1.66472 WP_011922168.1.66590 WP_011922168.1.66609 WP_011922168.1.6686 WP_011922168.1.67058 WP_011922168.1.67109 WP_011922168.1.6711 WP_011922168.1.67256 WP_011922168.1.67338 WP_011922168.1.67488 WP_011922168.1.677 WP_011922168.1.67883 WP_011922168.1.67897 WP_011922168.1.67958 WP_011922168.1.67962 WP_011922168.1.68303 WP_011922168.1.68666 WP_011922168.1.68739 WP_011922168.1.68791 WP_011922168.1.68941 WP_011922168.1.69115 WP_011922168.1.69161 WP_011922168.1.69413 WP_011922168.1.69454 WP_011922168.1.69698 WP_011922168.1.69706 WP_011922168.1.70387 WP_011922168.1.70817 WP_011922168.1.70997 WP_011922168.1.71125 WP_011922168.1.71140 WP_011922168.1.71498 WP_011922168.1.71727 WP_011922168.1.72174 WP_011922168.1.72247 WP_011922168.1.72413 WP_011922168.1.73011 WP_011922168.1.73262 WP_011922168.1.73280 WP_011922168.1.73299 WP_011922168.1.73679 WP_011922168.1.73721 WP_011922168.1.74567 WP_011922168.1.74800 WP_011922168.1.74843 WP_011922168.1.74865 WP_011922168.1.75022 WP_011922168.1.75605 WP_011922168.1.75985 WP_011922168.1.76083 WP_011922168.1.76175 WP_011922168.1.76400 WP_011922168.1.76735 WP_011922168.1.76907 WP_011922168.1.77006 WP_011922168.1.77616 WP_011922168.1.77624 WP_011922168.1.77795 WP_011922168.1.77958 WP_011922168.1.78326 WP_011922168.1.78456 WP_011922168.1.7873 WP_011922168.1.78744 WP_011922168.1.78792 WP_011922168.1.7889 WP_011922168.1.78945 WP_011922168.1.79154 WP_011922168.1.79162 WP_011922168.1.79644 WP_011922168.1.79679 WP_011922168.1.80097 WP_011922168.1.80131 WP_011922168.1.80169 WP_011922168.1.8061 WP_011922168.1.80716 WP_011922168.1.80742 WP_011922168.1.81513 WP_011922168.1.81584 WP_011922168.1.81705 WP_011922168.1.82122 WP_011922168.1.82830 WP_011922168.1.82977 WP_011922168.1.83818 WP_011922168.1.84389 WP_011922168.1.8451 WP_011922168.1.85075 WP_011922168.1.85327 WP_011922168.1.85437 WP_011922168.1.85908 WP_011922168.1.86151 WP_011922168.1.86177 WP_011922168.1.86842 WP_011922168.1.87044 WP_011922168.1.87321 WP_011922168.1.87344 WP_011922168.1.87438 WP_011922168.1.87450 WP_011922168.1.87819 WP_011922168.1.87874 WP_011922168.1.87885 WP_011922168.1.8790 WP_011922168.1.88543 WP_011922168.1.88575 WP_011922168.1.88653 WP_011922168.1.88779 WP_011922168.1.89037 WP_011922168.1.89038 WP_011922168.1.89128 WP_011922168.1.89279 WP_011922168.1.89358 WP_011922168.1.89388 WP_011922168.1.89800 WP_011922168.1.8993 WP_011922168.1.89989 WP_011922168.1.90172 WP_011922168.1.90419 WP_011922168.1.90742 WP_011922168.1.91238 WP_011922168.1.91636 WP_011922168.1.91865 WP_011922168.1.91973 WP_011922168.1.92134 WP_011922168.1.92263 WP_011922168.1.92441 WP_011922168.1.92554 WP_011922168.1.92692 WP_011922168.1.92722 WP_011922168.1.928 WP_011922168.1.93519 WP_011922168.1.9361 WP_011922168.1.93627 WP_011922168.1.93646 WP_011922168.1.9376 WP_011922168.1.94332 WP_011922168.1.94338 WP_011922168.1.94418 WP_011922168.1.94419 WP_011922168.1.94449 WP_011922168.1.9454 WP_011922168.1.94639 WP_011922168.1.94786 WP_011922168.1.94945 WP_011922168.1.95180 WP_011922168.1.95213 WP_011922168.1.95214 WP_011922168.1.95262 WP_011922168.1.95288 WP_011922168.1.95542 WP_011922168.1.95798 WP_011922168.1.96164 WP_011922168.1.96282 WP_011922168.1.96451 WP_011922168.1.9652 WP_011922168.1.96524 WP_011922168.1.96574 WP_011922168.1.96700 WP_011922168.1.97052 WP_011922168.1.97453 WP_011922168.1.97493 WP_011922168.1.97504 WP_011922168.1.97857 WP_011922168.1.9815 WP_011922168.1.98253 WP_011922168.1.98271 WP_011922168.1.98326 WP_011922168.1.98416 WP_011922168.1.98864 WP_011922168.1.98921 WP_011922168.1.99127 WP_011922168.1.9922 WP_011922168.1.99252 WP_011922168.1.99324 WP_011922168.1.99988 YP_003028961.1.79686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]