SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218494.SSU1169 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218494.SSU1169
Domain Number 1 Region: 18-330
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.08e-106
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000444
Further Details:      
 
Domain Number 2 Region: 367-444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000343
Family Glycosyl hydrolases family 32 C-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 218494.SSU1169
Sequence length 452
Comment (Streptococcus suis P1 7)
Sequence
MKTVVEANQFIQKEKGNVNPIFKPQAHLTPETGWMNDPNGFIYFRGEYHLFYQFNPYESV
WGPMHWGHAKSKDLVNWEQLPVDLAPDKAYDKDGCFSGSAIVKDDVLWLMYTGHIVNEDG
TVSQVQNMAFSTDGIHFEKIEQNPVATADGLPEEVIANDFRDPKIFEKDGHYYSVVATKH
KDNVGCIVLLSSPNLTDWKFESIFLKGEANQGFVWECPDYFEVDGQEYLIISPMRYQKDG
NDFININSNIFVTGHVDWDKKVFVAESFKEIDHGHDFYAAQTTEGPEGERVMIAWMHTWG
RPLVTNDLGHKWYGQMTLPRLLKQGENGLRQVLPAGILNSFDDIEIGQVIQGPSKLSLKL
DDSLDLKLGTDRDYLQFGYDKAKQEVYIDRSHLKIQQVGEEEWSTVRRAVTVQATELEVL
VDTNCLEIFINDGQETLTSTFYVEGQIILNAL
Download sequence
Identical sequences A0A0H3N2Z6 A0A2K1T0N8 D5AIH8 G7SLX1
gi|403061814|ref|YP_006650030.1| gi|386588442|ref|YP_006084843.1| gi|253755241|ref|YP_003028381.1| gi|386582256|ref|YP_006078660.1| 218494.SSU1169 391296.SSU98_1352 568813.SSUSC84_1202 568814.SSUBM407_0620 WP_012028321.1.10007 WP_012028321.1.100280 WP_012028321.1.100404 WP_012028321.1.100701 WP_012028321.1.100908 WP_012028321.1.101097 WP_012028321.1.101179 WP_012028321.1.101295 WP_012028321.1.101621 WP_012028321.1.101658 WP_012028321.1.101706 WP_012028321.1.102038 WP_012028321.1.10265 WP_012028321.1.1035 WP_012028321.1.10700 WP_012028321.1.10896 WP_012028321.1.11017 WP_012028321.1.11330 WP_012028321.1.11548 WP_012028321.1.11662 WP_012028321.1.11869 WP_012028321.1.11874 WP_012028321.1.1200 WP_012028321.1.12022 WP_012028321.1.12228 WP_012028321.1.12288 WP_012028321.1.1244 WP_012028321.1.12606 WP_012028321.1.12803 WP_012028321.1.13095 WP_012028321.1.1324 WP_012028321.1.13380 WP_012028321.1.13633 WP_012028321.1.13861 WP_012028321.1.1405 WP_012028321.1.14202 WP_012028321.1.14210 WP_012028321.1.1424 WP_012028321.1.1434 WP_012028321.1.14359 WP_012028321.1.1495 WP_012028321.1.15112 WP_012028321.1.1537 WP_012028321.1.15393 WP_012028321.1.15545 WP_012028321.1.15756 WP_012028321.1.15813 WP_012028321.1.16193 WP_012028321.1.1629 WP_012028321.1.16498 WP_012028321.1.16643 WP_012028321.1.16683 WP_012028321.1.16773 WP_012028321.1.16829 WP_012028321.1.16881 WP_012028321.1.17264 WP_012028321.1.17670 WP_012028321.1.17749 WP_012028321.1.17814 WP_012028321.1.17958 WP_012028321.1.17989 WP_012028321.1.18271 WP_012028321.1.18341 WP_012028321.1.18403 WP_012028321.1.18563 WP_012028321.1.18711 WP_012028321.1.18850 WP_012028321.1.19352 WP_012028321.1.19378 WP_012028321.1.1953 WP_012028321.1.19865 WP_012028321.1.19898 WP_012028321.1.20400 WP_012028321.1.20518 WP_012028321.1.20584 WP_012028321.1.20756 WP_012028321.1.20944 WP_012028321.1.21347 WP_012028321.1.21457 WP_012028321.1.21903 WP_012028321.1.22785 WP_012028321.1.22882 WP_012028321.1.23089 WP_012028321.1.23273 WP_012028321.1.23317 WP_012028321.1.23358 WP_012028321.1.23682 WP_012028321.1.23965 WP_012028321.1.24078 WP_012028321.1.24150 WP_012028321.1.24175 WP_012028321.1.24187 WP_012028321.1.24431 WP_012028321.1.24858 WP_012028321.1.24883 WP_012028321.1.25245 WP_012028321.1.25280 WP_012028321.1.25381 WP_012028321.1.25396 WP_012028321.1.25617 WP_012028321.1.25711 WP_012028321.1.25824 WP_012028321.1.25950 WP_012028321.1.26009 WP_012028321.1.26302 WP_012028321.1.26368 WP_012028321.1.26620 WP_012028321.1.27108 WP_012028321.1.27225 WP_012028321.1.27227 WP_012028321.1.27381 WP_012028321.1.27476 WP_012028321.1.27695 WP_012028321.1.27754 WP_012028321.1.27760 WP_012028321.1.27767 WP_012028321.1.28000 WP_012028321.1.28033 WP_012028321.1.28244 WP_012028321.1.28467 WP_012028321.1.28796 WP_012028321.1.28805 WP_012028321.1.29141 WP_012028321.1.29610 WP_012028321.1.30079 WP_012028321.1.30241 WP_012028321.1.30414 WP_012028321.1.30785 WP_012028321.1.31418 WP_012028321.1.31597 WP_012028321.1.31730 WP_012028321.1.32259 WP_012028321.1.32332 WP_012028321.1.32466 WP_012028321.1.32630 WP_012028321.1.32947 WP_012028321.1.33330 WP_012028321.1.33494 WP_012028321.1.34321 WP_012028321.1.34425 WP_012028321.1.34527 WP_012028321.1.34652 WP_012028321.1.34738 WP_012028321.1.35430 WP_012028321.1.35551 WP_012028321.1.35675 WP_012028321.1.35725 WP_012028321.1.36136 WP_012028321.1.36251 WP_012028321.1.36341 WP_012028321.1.36611 WP_012028321.1.36766 WP_012028321.1.36945 WP_012028321.1.37126 WP_012028321.1.37237 WP_012028321.1.376 WP_012028321.1.37653 WP_012028321.1.37688 WP_012028321.1.37816 WP_012028321.1.37841 WP_012028321.1.37915 WP_012028321.1.38409 WP_012028321.1.38470 WP_012028321.1.39011 WP_012028321.1.39023 WP_012028321.1.39247 WP_012028321.1.39280 WP_012028321.1.39714 WP_012028321.1.3989 WP_012028321.1.40062 WP_012028321.1.40141 WP_012028321.1.40228 WP_012028321.1.40384 WP_012028321.1.40507 WP_012028321.1.40669 WP_012028321.1.4074 WP_012028321.1.40802 WP_012028321.1.41046 WP_012028321.1.41112 WP_012028321.1.41280 WP_012028321.1.41340 WP_012028321.1.41854 WP_012028321.1.42323 WP_012028321.1.42552 WP_012028321.1.42596 WP_012028321.1.42732 WP_012028321.1.4278 WP_012028321.1.42784 WP_012028321.1.42827 WP_012028321.1.42840 WP_012028321.1.4291 WP_012028321.1.43264 WP_012028321.1.43288 WP_012028321.1.43482 WP_012028321.1.43813 WP_012028321.1.43922 WP_012028321.1.43963 WP_012028321.1.43977 WP_012028321.1.44047 WP_012028321.1.44128 WP_012028321.1.44592 WP_012028321.1.44676 WP_012028321.1.44778 WP_012028321.1.45088 WP_012028321.1.45219 WP_012028321.1.45278 WP_012028321.1.45345 WP_012028321.1.45864 WP_012028321.1.467 WP_012028321.1.46880 WP_012028321.1.47315 WP_012028321.1.47375 WP_012028321.1.47434 WP_012028321.1.4748 WP_012028321.1.4757 WP_012028321.1.47643 WP_012028321.1.47745 WP_012028321.1.47894 WP_012028321.1.47900 WP_012028321.1.48167 WP_012028321.1.48217 WP_012028321.1.48397 WP_012028321.1.48603 WP_012028321.1.49093 WP_012028321.1.49099 WP_012028321.1.49206 WP_012028321.1.49255 WP_012028321.1.49368 WP_012028321.1.49413 WP_012028321.1.49509 WP_012028321.1.49782 WP_012028321.1.49968 WP_012028321.1.50047 WP_012028321.1.5021 WP_012028321.1.50437 WP_012028321.1.50538 WP_012028321.1.50551 WP_012028321.1.50675 WP_012028321.1.50751 WP_012028321.1.5079 WP_012028321.1.50798 WP_012028321.1.51263 WP_012028321.1.51386 WP_012028321.1.51551 WP_012028321.1.52159 WP_012028321.1.52175 WP_012028321.1.52599 WP_012028321.1.52628 WP_012028321.1.52798 WP_012028321.1.53174 WP_012028321.1.53290 WP_012028321.1.53309 WP_012028321.1.534 WP_012028321.1.53448 WP_012028321.1.53749 WP_012028321.1.53805 WP_012028321.1.54000 WP_012028321.1.5404 WP_012028321.1.54184 WP_012028321.1.54384 WP_012028321.1.54488 WP_012028321.1.54535 WP_012028321.1.54800 WP_012028321.1.54828 WP_012028321.1.55064 WP_012028321.1.55137 WP_012028321.1.55158 WP_012028321.1.55649 WP_012028321.1.55687 WP_012028321.1.5579 WP_012028321.1.55815 WP_012028321.1.55833 WP_012028321.1.55834 WP_012028321.1.56140 WP_012028321.1.56215 WP_012028321.1.56434 WP_012028321.1.56463 WP_012028321.1.57067 WP_012028321.1.5714 WP_012028321.1.57164 WP_012028321.1.5754 WP_012028321.1.57640 WP_012028321.1.57674 WP_012028321.1.57810 WP_012028321.1.58229 WP_012028321.1.58517 WP_012028321.1.58566 WP_012028321.1.58585 WP_012028321.1.58706 WP_012028321.1.58746 WP_012028321.1.58793 WP_012028321.1.58815 WP_012028321.1.58903 WP_012028321.1.59071 WP_012028321.1.59138 WP_012028321.1.59144 WP_012028321.1.59283 WP_012028321.1.59349 WP_012028321.1.59524 WP_012028321.1.59647 WP_012028321.1.5974 WP_012028321.1.60237 WP_012028321.1.60293 WP_012028321.1.60377 WP_012028321.1.60445 WP_012028321.1.60658 WP_012028321.1.60659 WP_012028321.1.60853 WP_012028321.1.609 WP_012028321.1.61370 WP_012028321.1.61533 WP_012028321.1.61540 WP_012028321.1.6156 WP_012028321.1.6165 WP_012028321.1.61782 WP_012028321.1.6223 WP_012028321.1.62268 WP_012028321.1.62485 WP_012028321.1.6278 WP_012028321.1.62805 WP_012028321.1.63318 WP_012028321.1.63653 WP_012028321.1.63685 WP_012028321.1.63959 WP_012028321.1.64128 WP_012028321.1.64273 WP_012028321.1.64281 WP_012028321.1.64384 WP_012028321.1.64641 WP_012028321.1.64797 WP_012028321.1.64952 WP_012028321.1.65024 WP_012028321.1.65047 WP_012028321.1.65174 WP_012028321.1.65314 WP_012028321.1.65422 WP_012028321.1.65458 WP_012028321.1.65905 WP_012028321.1.65911 WP_012028321.1.65917 WP_012028321.1.6596 WP_012028321.1.66185 WP_012028321.1.66472 WP_012028321.1.66609 WP_012028321.1.66707 WP_012028321.1.6686 WP_012028321.1.6690 WP_012028321.1.66954 WP_012028321.1.67058 WP_012028321.1.67109 WP_012028321.1.6711 WP_012028321.1.67256 WP_012028321.1.67338 WP_012028321.1.677 WP_012028321.1.67883 WP_012028321.1.67897 WP_012028321.1.67958 WP_012028321.1.67962 WP_012028321.1.68010 WP_012028321.1.68303 WP_012028321.1.68602 WP_012028321.1.68666 WP_012028321.1.68739 WP_012028321.1.68791 WP_012028321.1.68941 WP_012028321.1.69115 WP_012028321.1.69413 WP_012028321.1.69454 WP_012028321.1.69698 WP_012028321.1.69706 WP_012028321.1.69922 WP_012028321.1.70033 WP_012028321.1.70387 WP_012028321.1.70817 WP_012028321.1.70997 WP_012028321.1.71125 WP_012028321.1.71140 WP_012028321.1.71425 WP_012028321.1.71498 WP_012028321.1.71727 WP_012028321.1.72174 WP_012028321.1.72247 WP_012028321.1.72296 WP_012028321.1.72413 WP_012028321.1.73011 WP_012028321.1.73262 WP_012028321.1.73280 WP_012028321.1.73299 WP_012028321.1.73679 WP_012028321.1.73721 WP_012028321.1.73905 WP_012028321.1.74567 WP_012028321.1.74800 WP_012028321.1.74843 WP_012028321.1.74865 WP_012028321.1.75022 WP_012028321.1.75028 WP_012028321.1.75605 WP_012028321.1.75930 WP_012028321.1.75965 WP_012028321.1.75985 WP_012028321.1.76083 WP_012028321.1.76175 WP_012028321.1.76400 WP_012028321.1.76735 WP_012028321.1.76907 WP_012028321.1.77006 WP_012028321.1.77616 WP_012028321.1.77624 WP_012028321.1.77781 WP_012028321.1.77795 WP_012028321.1.77958 WP_012028321.1.78326 WP_012028321.1.78456 WP_012028321.1.7873 WP_012028321.1.78744 WP_012028321.1.78792 WP_012028321.1.7889 WP_012028321.1.78945 WP_012028321.1.79054 WP_012028321.1.79154 WP_012028321.1.79162 WP_012028321.1.79499 WP_012028321.1.79644 WP_012028321.1.79679 WP_012028321.1.80097 WP_012028321.1.80131 WP_012028321.1.80153 WP_012028321.1.80169 WP_012028321.1.80216 WP_012028321.1.8061 WP_012028321.1.80716 WP_012028321.1.80742 WP_012028321.1.81103 WP_012028321.1.81370 WP_012028321.1.81513 WP_012028321.1.81584 WP_012028321.1.81705 WP_012028321.1.82122 WP_012028321.1.8251 WP_012028321.1.82830 WP_012028321.1.82870 WP_012028321.1.82977 WP_012028321.1.83818 WP_012028321.1.83915 WP_012028321.1.84389 WP_012028321.1.8451 WP_012028321.1.85051 WP_012028321.1.85075 WP_012028321.1.85327 WP_012028321.1.85437 WP_012028321.1.85908 WP_012028321.1.86151 WP_012028321.1.86177 WP_012028321.1.86817 WP_012028321.1.86836 WP_012028321.1.86842 WP_012028321.1.87044 WP_012028321.1.87321 WP_012028321.1.87344 WP_012028321.1.87438 WP_012028321.1.87450 WP_012028321.1.87819 WP_012028321.1.87874 WP_012028321.1.87885 WP_012028321.1.8790 WP_012028321.1.88543 WP_012028321.1.88575 WP_012028321.1.88653 WP_012028321.1.88779 WP_012028321.1.89037 WP_012028321.1.89038 WP_012028321.1.89056 WP_012028321.1.89128 WP_012028321.1.89156 WP_012028321.1.89279 WP_012028321.1.89358 WP_012028321.1.89388 WP_012028321.1.89800 WP_012028321.1.8993 WP_012028321.1.89989 WP_012028321.1.90172 WP_012028321.1.90419 WP_012028321.1.90742 WP_012028321.1.90961 WP_012028321.1.91238 WP_012028321.1.91636 WP_012028321.1.91865 WP_012028321.1.91912 WP_012028321.1.91973 WP_012028321.1.91983 WP_012028321.1.92134 WP_012028321.1.92263 WP_012028321.1.92441 WP_012028321.1.92554 WP_012028321.1.92692 WP_012028321.1.92722 WP_012028321.1.928 WP_012028321.1.93190 WP_012028321.1.93456 WP_012028321.1.93519 WP_012028321.1.9361 WP_012028321.1.93627 WP_012028321.1.93646 WP_012028321.1.9376 WP_012028321.1.93771 WP_012028321.1.94332 WP_012028321.1.94338 WP_012028321.1.94418 WP_012028321.1.94419 WP_012028321.1.94449 WP_012028321.1.9454 WP_012028321.1.94639 WP_012028321.1.94786 WP_012028321.1.94945 WP_012028321.1.95180 WP_012028321.1.95213 WP_012028321.1.95214 WP_012028321.1.95262 WP_012028321.1.95288 WP_012028321.1.95542 WP_012028321.1.95798 WP_012028321.1.96164 WP_012028321.1.96282 WP_012028321.1.96451 WP_012028321.1.9652 WP_012028321.1.96524 WP_012028321.1.96574 WP_012028321.1.96700 WP_012028321.1.97052 WP_012028321.1.97453 WP_012028321.1.97493 WP_012028321.1.97504 WP_012028321.1.97554 WP_012028321.1.97857 WP_012028321.1.9809 WP_012028321.1.9815 WP_012028321.1.98253 WP_012028321.1.98271 WP_012028321.1.98326 WP_012028321.1.98343 WP_012028321.1.98416 WP_012028321.1.98860 WP_012028321.1.98864 WP_012028321.1.98921 WP_012028321.1.99127 WP_012028321.1.9922 WP_012028321.1.99252 WP_012028321.1.99324 WP_012028321.1.99696 WP_012028321.1.99988 YP_003028381.1.79686 gi|253752058|ref|YP_003025199.1| gi|476420185|ref|YP_007571181.1| gi|389856288|ref|YP_006358531.1| gi|386580233|ref|YP_006076638.1| gi|386578179|ref|YP_006074585.1| gi|253753883|ref|YP_003027024.1| gi|146321199|ref|YP_001200910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]