SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218495.SUB0731 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218495.SUB0731
Domain Number 1 Region: 4-166
Classification Level Classification E-value
Superfamily PRTase-like 4.35e-39
Family Phosphoribosyltransferases (PRTases) 0.00000444
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 218495.SUB0731
Sequence length 173
Comment (Streptococcus uberis 0140J)
Sequence
MKKKEIVDDVTMKRAITRITYEIIERNKSLDNLVLAGIKTRGVYLARRIQERLKQLEGIE
LPIGELDIKPFRDDMKVEEDTTDMPFDINGKDVILVDDVLYTGRTIRAAIDNLVSLGRPA
RVGLAVLVDRGHRELPIRADYVGKNIPTSSIEEIVVEVIEVDGKDCVSIVDPS
Download sequence
Identical sequences B9DU60
218495.SUB0731 gi|222152893|ref|YP_002562070.1| WP_012658248.1.37397 WP_012658248.1.4990 WP_012658248.1.51754 WP_012658248.1.65710 WP_012658248.1.69183 WP_012658248.1.69259 WP_012658248.1.70036 WP_012658248.1.70882 WP_012658248.1.78160 WP_012658248.1.84361 WP_012658248.1.87423 WP_012658248.1.93969 WP_012658248.1.94620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]