SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218495.SUB1344 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218495.SUB1344
Domain Number 1 Region: 10-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-41
Family Beta-D-xylosidase C-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 218495.SUB1344
Sequence length 210
Comment (Streptococcus uberis 0140J)
Sequence
MKVYDSKEMVWTREPKSFSISNQEIVIETQPHTDLWQRTYYHFQNDNAPLLQMTIEDDYF
SFVVKTTFNSKHRFDQCGLVMYLDSENWLKASIEYENEDFQHLGSVVTNQGYSDWATTEI
DASIKEMWYRLSRRGNDFRLECSQDGQTFKQMRICHMAKATGPIQCGIYACSPEDSSFTA
RFTDLQVLECQWPSHDGQAPDEVVSSITNL
Download sequence
Identical sequences B9DV03
gi|222153467|ref|YP_002562644.1| 218495.SUB1344 WP_015911666.1.51754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]