SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218495.SUB1392 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218495.SUB1392
Domain Number 1 Region: 335-485
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.88e-27
Family HD domain 0.028
Further Details:      
 
Domain Number 2 Region: 223-319
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.75e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 218495.SUB1392
Sequence length 535
Comment (Streptococcus uberis 0140J)
Sequence
MINIILLIVCALIGLIIGYAMISLKLKKAKESADLTLLNAEQDAVNIRGKAVAEADHIRE
SAERESKANRKELLLEAKEEARKYREEIEQEFKSERQELKQLETRLNERAFSLDRKDENL
TSKEKVLDSKEQSLTDKSKHIDERQTEVERLEEVKKEELQRVAAMTIAEAREVILMETET
KLTQEIASRIRDAEREIKDRANKTAKDLLSQAMQRVAGEYVTEQTITSVHLPDDNMKGRI
IGREGRNIRTLESLTGIDVIIDDTPEVVVLSGFDPIRREIARMTLESLISDGRIHPARIE
ELVEKNRLEMDNRIREYGEAAAYEIGAPNLHPDLIKIMGRLQFRTSYGQNVLRHSVEVGK
LAGILAGELGENVALARRAGFLHDMGKAIDREVEGSHVEIGMEFARKYKEHPVVINTIAS
HHGDVEPESVIAVIVAAADALSSARPGARNESMENYIKRLRDLEEIATSFDGVQNSFALQ
AGREIRIMVQPEKVSDDEVVILSHKVREKIENNLDYPGNIKVTVIREMRAIDYAK
Download sequence
Identical sequences B9DV49
218495.SUB1392 WP_015911712.1.51754 WP_015911712.1.93969 gi|222153513|ref|YP_002562690.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]