SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218495.SUB1400 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  218495.SUB1400
Domain Number - Region: 21-58
Classification Level Classification E-value
Superfamily BT0923-like 0.0706
Family BT0923-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 218495.SUB1400
Sequence length 112
Comment (Streptococcus uberis 0140J)
Sequence
MKAIFKNQMVEVWQVSKEGSQPQWVKSAFEKNYFQWIDNHVRVLMVGYNPSLENNVKIGL
VGSAAGGGFAGYHMYQNAYLGDYIDATNFKILSAKQFAKKYRLVSEENSITE
Download sequence
Identical sequences B9DV57
WP_015911720.1.37397 WP_015911720.1.51754 WP_015911720.1.65710 WP_015911720.1.69183 WP_015911720.1.69259 WP_015911720.1.70036 WP_015911720.1.70882 WP_015911720.1.78160 WP_015911720.1.84361 WP_015911720.1.93969 WP_015911720.1.94620 gi|222153521|ref|YP_002562698.1| 218495.SUB1400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]