SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218495.SUB1615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218495.SUB1615
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.28e-27
Family Ribosomal protein S14 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 218495.SUB1615
Sequence length 89
Comment (Streptococcus uberis 0140J)
Sequence
MAKKSKIAKYHKQLQLIEQYAERRRELKAAGDYEALRKLPRDSNPNRLKNRDKIDGRPHA
YMRQFGVSRINFRNLAHKGQLPGVTKASW
Download sequence
Identical sequences B9DVQ6
218495.SUB1615 gi|222153717|ref|YP_002562894.1| WP_015911914.1.37397 WP_015911914.1.4990 WP_015911914.1.51754 WP_015911914.1.65710 WP_015911914.1.69183 WP_015911914.1.69259 WP_015911914.1.70036 WP_015911914.1.70882 WP_015911914.1.78160 WP_015911914.1.84361 WP_015911914.1.87423 WP_015911914.1.93969 WP_015911914.1.94620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]