SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218495.SUBp01 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218495.SUBp01
Domain Number 1 Region: 6-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-44
Family Ribonuclease PH domain 1-like 0.0000389
Further Details:      
 
Domain Number 2 Region: 297-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-42
Family Ribonuclease PH domain 1-like 0.0000108
Further Details:      
 
Domain Number 3 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.62e-29
Family Ribonuclease PH domain 2-like 0.0018
Further Details:      
 
Domain Number 4 Region: 453-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-28
Family Ribonuclease PH domain 2-like 0.0000942
Further Details:      
 
Domain Number 5 Region: 623-706
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.72e-21
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 6 Region: 559-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.28e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 7 Region: 236-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000118
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 218495.SUBp01
Sequence length 732
Comment (Streptococcus uberis 0140J)
Sequence
MSKQTFSTTFAGKPLVVEVGQVAKQANGATVVRYGESTVLTAAVMSKKMATGDFFPLQVN
YEEKMYAAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEGFRNEIQVINTVLSYDE
NASAPMAAMFGSSLALSISDIPFNGPIAGVQVGYIDGEFIINPDKAQMEASLLELTVAGS
KEAINMVESGAKELSEDIMLEALLKGHQAIQELIAFQEEIVAAVGKEKAEVELLQVDADL
QAEIVAKYNADLQKAVQVEEKKAREAATEAVKETVKAEYEAKFAEDENLATIMRDVAEIL
EQMEHAEVRRLITEDKVRPDGRKVDEIRPLDAQIDFLPKVHGSGLFTRGQTQALSVLTLA
PMGDTQIIDGLDDEYKKRFLHHYNFPQYSVGETGRYGAAGRREIGHGALGERALEQVLPS
LEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGVPIKAPVAGIAMGLISDGTNYTV
LTDIQGLEDHFGDMDFKVAGTRDGITALQMDIKIEGITPQILEEALAQAKKARFEILDLI
ETTIPAPRPELAPTAPKIDTIQIDVDKIKIVIGKGGETIDKIIAETGVKIDIDEEGLVQI
FSSDQAAIDRTKEIITSLVREAKVGEVYHAKVVRIEKFGAFVNLFDKTDALVHISEIAWT
RTANVSDVLEVGEEVDVKVIKVDDKGRVDASMKALIPRPPKPEKKEEKASEAKEASNDQA
SKSQSETASEEK
Download sequence
Identical sequences B9DTE3
WP_012657815.1.51754 WP_012657815.1.65710 WP_012657815.1.84361 WP_012657815.1.94620 218495.SUBp01 gi|222152456|ref|YP_002561631.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]