SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218496.TW347 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218496.TW347
Domain Number 1 Region: 7-147
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-44
Family Ribonuclease PH domain 1-like 0.000000893
Further Details:      
 
Domain Number 2 Region: 332-503
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-40
Family Ribonuclease PH domain 1-like 0.00000157
Further Details:      
 
Domain Number 3 Region: 485-584
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.94e-22
Family Ribonuclease PH domain 2-like 0.0000298
Further Details:      
 
Domain Number 4 Region: 148-257
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.16e-21
Family Ribonuclease PH domain 2-like 0.0000363
Further Details:      
 
Domain Number 5 Region: 586-697
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.01e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 6 Region: 257-361
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000101
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 218496.TW347
Sequence length 735
Comment (Tropheryma whipplei TW08 27)
Sequence
MQFSEGVIDNGRFGTRTIRFETGRLARQAQGSVVAYLDGETMLLSSTSVGKQPKEDCDFF
PLTVDVEERSYAAGKIPGSYFRREGRPSTEAILACRLIDRPLRPSFNAGLRNEVQVIVTV
LSIAPGEFYEALAINAASASTLVSGLPFSGPIGGVRLALIDGQWVAFPRYEDLSGAVFDL
TVAGRVFVNESGKEDIAIMMVEAEATEPAWDLIHSHGAKKPNEEVIEEGIESAKVFIRTL
CDIQRDLASKLSLSHTEPDLYPDYSDSVHSFVEGLVKSDLEKVYRGNHDSGYAPNALSAS
DEIKQKAYDAFHDAVLSGRFDQDSLSQFPHAYKAVLKDVVRTCVLEGFARMDGRGLSDIR
PLDAEVQVVPRVHGSAVFQRGETQVLGVTTLNMLKMEQQIDSLAPIVSKRYIHHYNFPPY
STGEVGRVGSPKRREIGHGFLAERALVPVLPSREDFPYAIRQVSEALGSNGSTSMGSVCA
STLSLLNAGVPLRAPVAGIAMGLISGRVDGEMRYVTLTDISGSEDALGDMDFKVAGTSDF
ITALQLDTKLDGIPAHVLSEALAHARSARLAILDVLTRVIDSPDQMSEYAPRVVRVKIPV
QKIGELIGPKGKVINSIQDETGAEISIEDDGTVYIGSSQADSSEKAVAMVNSIVNPVEPC
VGSQFLGTVVKNMPFGSFISLVPGKDGLLHISEIRKMVDGRHLESVDEVLSVGQKVLVEV
SKIDDRGKLCLVAVK
Download sequence
Identical sequences Q820Y9
gi|28572501|ref|NP_789281.1| 218496.TW347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]