SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218496.TW497 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218496.TW497
Domain Number 1 Region: 109-164
Classification Level Classification E-value
Superfamily PKD domain 0.000000916
Family PKD domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 218496.TW497
Sequence length 210
Comment (Tropheryma whipplei TW08 27)
Sequence
MKHPRPNRGGHGRKRVGSVSPSRVKPDWHYVRGTDTLCAPGTWGCAPLGNDKPPGKTPVR
KPIKRSISIRDLYDQKRIAPPPPTISVKPYALVRRPVDITAIARSRSGTFNLLGDDFDVR
IYPVRYSWTYGDGYSDVSYTNRASHVYGQVGNRIVTLRVFYRAKVNWGTGWEPAIGEIFL
DAQPRNIDVFGWKISLFADNCYTNPFGQGC
Download sequence
Identical sequences gi|28572646|ref|NP_789426.1| 218496.TW497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]