SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 220664.PFL_0628 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220664.PFL_0628
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.57e-29
Family Chaperone J-domain 0.00027
Further Details:      
 
Domain Number 2 Region: 130-226
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.44e-16
Family HSP40/DnaJ peptide-binding domain 0.0036
Further Details:      
 
Domain Number 3 Region: 219-301
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 7.46e-16
Family HSP40/DnaJ peptide-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 220664.PFL_0628
Sequence length 318
Comment (Pseudomonas fluorescens Pf-5)
Sequence
MVIPSMDFKDYYKILGVEPTADDKAIKAAYRKLARKYHPDVSKEKDAEAKFKDASEAYEA
LKSADKRAEYDDLRKYGQHGQPFQGPPGWQSRGGFGGGEDGGDFSDFFSSIFGNRGPGFG
GPEQRRSSGRRGQDVEMELPIFLEETLSTESKKISFQVPQYNANGQHVSNTSKSLNVKIP
AGVTDGERIRLKGQGAPGVGGGANGDLYLTIRFAPHPKFDVEGENLIITLPLAPWELALG
TEVAVPTLTGKINLKVPAGSQNGQRMRAKGHGLLNKAGQRGYLFVQLKAVMPKQAGDDVK
ALWQELAKKAAFDPRENF
Download sequence
Identical sequences A0A2C9EFM4
220664.PFL_0628 gi|501678112|ref|YP_007997938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]