SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 220664.PFL_0848 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220664.PFL_0848
Domain Number 1 Region: 296-491
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.08e-50
Family Ribonuclease PH domain 1-like 0.0000177
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-47
Family Ribonuclease PH domain 1-like 0.0000189
Further Details:      
 
Domain Number 3 Region: 453-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.79e-28
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 4 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.23e-26
Family Ribonuclease PH domain 2-like 0.00088
Further Details:      
 
Domain Number 5 Region: 558-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.42e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 6 Region: 617-695
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.36e-21
Family Cold shock DNA-binding domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 220664.PFL_0848
Sequence length 703
Comment (Pseudomonas fluorescens Pf-5)
Sequence
MNPVIKKFQFGQSTVTLETGRIARQASGAVLVTVDDDVSVLVTVVGAKQADPGKGFFPLS
VHYQEKTYAAGKIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPEGFMNEVQVVCTVVST
SKKTDPDIAAMIGTSAALAISGIPFDGPIGAARVAFHESTGYLLNPTYEQLAASSLDMVV
AGTEEAVLMVESEAKELTEDQMLGAVLFAHDEFQSVIKAVKELAAEAAKPTWDWDWAAAP
EATELLGAIRAEFGEAISQAYTITVKADRYARLGELKDQVVAKLSGEEGQPSASDVKAAF
GEIEYRTVRENIVNGKPRIDGRDTRTVRPLNIEVGVLPKTHGSALFTRGETQALVVATLG
TARDAQLLDTLEGEKKDPFMLHYNFPPFSVGECGRMGGAGRREIGHGRLARRSVQAMLPA
ADVFPYTIRVVSEITESNGSSSMASVCGASLALMDAGVPMKAPVAGIAMGLVKEGEKFAV
LTDILGDEDHLGDMDFKVAGTAKGVTALQMDIKIKGITEEIMEIALGQALEARLNILGQM
NQIIGQSRTELSANAPTMIAMKIDTDKIRDVIGKGGATIRAICEETKASIDIEDDGSIKI
FGETKEAAEAARQRVLGITAEAEIGKIYVGKVERIVDFGAFVNILPGKDGLVHISMLSDA
RVEKVTDILKEGQEVEVLVLDVDNRGRIKLSIKDVAAAKASGV
Download sequence
Identical sequences Q4KIF2
220664.PFL_0848 WP_011059206.1.14038 gi|70734341|ref|YP_257981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]