SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 220664.PFL_2309 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220664.PFL_2309
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000027
Family Glutathione S-transferase (GST), N-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 81-205
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000929
Family Glutathione S-transferase (GST), C-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 220664.PFL_2309
Sequence length 212
Comment (Pseudomonas fluorescens Pf-5)
Sequence
MYHLYGSQGTGSAIVEIALEYCQLAYRRIEAAPWEDNPGREALARLNPLLQIPTLQLPDG
SILTESAAILIHLGLEFPDSGLLPAPASARAQVIRGLVYIAANCYSAIGILDYPERWISD
PDEPLKARVRAAAAERLYRSWGLFAEQFASRPYFGGAAPGALDIQAAVVSRWSGAREHLR
DSHPDFLALLQRIDREPRIAAVLARHWPPASS
Download sequence
Identical sequences Q4KEB7
WP_011060607.1.100210 WP_011060607.1.14038 WP_011060607.1.18072 220664.PFL_2309 gi|70729677|ref|YP_259416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]