SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 220664.PFL_2821 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220664.PFL_2821
Domain Number 1 Region: 135-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-29
Family Laminin G-like module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 220664.PFL_2821
Sequence length 605
Comment (Pseudomonas fluorescens Pf-5)
Sequence
MQRLFLSLLICLGFVLPATAHAWWQDDWHYRKQISVDTTPQGAPINEALGRTALLVRLHT
GNFTFDGVKEDGADLRFVAADDKTLLNHQIESFDPLMGMALIWVDVPKVEGGQRQDIWMY
YGNQKAPSTANGQLTFDPSYTAIYHFDGSNGTPAKDTTAYGNTAQNATGAAIDGVIGRAL
QFSGQPLLLPASPSLQHNAGGAFTFSAWVRLDQASGEQLLLARREGVGSLLIGINQGMPF
VEVDGQRAASTQPLNPGQWQHLALSGEGSRLALYVNGRETASLAQAIPTFNSPLAIGADL
PAAAGAEASHFQPFTGALDELRLSKVARPAALILADASAQGAESKLVAYGVDEEQSGFGF
GSLGFLLKAVPVDAWVIILVLVGMMIQSWVIMLRKNRMVGRVSAANALFREQFAKVGTRL
EMFADDQVLASRLEHSSLWRLYLVAVKEIRTRREQGADTSSVSAATIEAIRCSMDGVRTR
ENQQLSSKLSTLSNAIAGGPYIGLLGTVLGIMVVFLGTAMAGDVNINAIAPGMAAALLAT
AMGLFVAIPALFGYNRLITRNKEVGADMRVFVDEFITRLAELHGESQHSENAHWRVSHSN
ASVPA
Download sequence
Identical sequences Q4KCV6
220664.PFL_2821 gi|70730188|ref|YP_259927.1| WP_011061112.1.14038 WP_011061112.1.18072 WP_011061112.1.42693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]