SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 220664.PFL_4740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220664.PFL_4740
Domain Number 1 Region: 4-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-53
Family Alginate lyase 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 220664.PFL_4740
Sequence length 226
Comment (Pseudomonas fluorescens Pf-5)
Sequence
MAGDILPFMITTPVASSPSNPVALELTVPQALAQVTQVISQLPYGSIRMSAPPLGASSKR
THRTRCEWNEPLYWSLASAQLHRNRQVMRLAQVNSAQKVVISQMHVKDDDSPAVKVFWNK
GRIAWGFRASFDQGGSATRIIATNVPLQAPFEITLSTTTAGLVLVVVICNGVTSTSTPAQ
LDSSWNDQRFDFRGRVYNQVDYSGSTPASDGSVCIISELQVSHTLA
Download sequence
Identical sequences Q4K7G1
220664.PFL_4740 gi|70732066|ref|YP_261822.1| WP_011062997.1.14038 WP_011062997.1.18072 WP_011062997.1.42693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]