SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 220668.lp_0072 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220668.lp_0072
Domain Number 1 Region: 17-165
Classification Level Classification E-value
Superfamily PUA domain-like 2.39e-50
Family Hypothetical protein EF3133 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 220668.lp_0072
Sequence length 166
Comment (Lactobacillus plantarum)
Sequence
MGAYVKLKTDHNLEVIIMDVQSFFEQAKTTLKLTQSTPLQSAYQFGSDPDKLAQLVLTGT
KTATTSAYDLYETDEPLPKVGAYDVILDAHNQPVCVTRTDQVMITPYLDIDATHAYLEGE
GDRTYAYWRRVHDAFFKQEYQSEHQRFDPHTAQMVLERFHVVYPVH
Download sequence
Identical sequences D7VDS2
220668.lp_0072 644042.JDM1_0080 gi|308179250|ref|YP_003923378.1| gi|501145396|ref|YP_007985734.1| gi|254555249|ref|YP_003061666.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]