SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 220668.lp_1229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220668.lp_1229
Domain Number 1 Region: 275-408,440-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-21
Family Legume lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 220668.lp_1229
Sequence length 1010
Comment (Lactobacillus plantarum)
Sequence
MLKKDNFGEHKTHYKLYKCGKNWAIMGITLVSLGVGTVTMTRAAAADSEVTNDSASQHVT
SISTDASKNQHTSSNVILTNDDKSVSASINQDASASVVNKAVSATSQENSSVQNTSQATS
TSKQESSSTKNTSQTTSTSNQEANSAKSINQTTRTSKQESSSTKNTSQTTSTSNQEANSA
KSINQTTRTSNQESSSAKNTSQTTSTSSRKINSTKSQAQSLTITTTGKAVRATSTSVKKY
STKTKVSYSTLLQQLRTSKALISDEAALTHVDKDNFLKYFSLNGSATYDAKTGIVTITPN
QNNQVGNFSLTSKIDMNKSFTLTGQVNLGSNPNGADGIGFAFHSGNTTDVGNAGGNLGIG
GLQDAIGFKLDTWFNSYQAPSSDKNGSEISSTNSNGFGWNGDSANAPYGTFVKTSNQEIS
TANGSKVQRWWAQDTGESQALSKADIDGNFHDFVVNYDGATRTLTVSYTQASGKVLTWKT
TVDSSYQAMAMVVSASTGAAKNLQQFKLTSFDFQEAATVNVKYVDTTGHQLAQGTANYPD
GAYVNGRYTTKQLIIPNYRFIKMDDGSVTGTKSLDANGTLIQSGDNGTVIYVYVPEYMAI
VKTVNETINYVDENGHALTTSYTANPIHILTVTNPVDGTTTTYYSTITTSIELDATTGRP
VDSGWVLGNSQDFDAVTNPQIKGYTVTSTDAPNSDLQHVSAQTVTGDSGDLEFTVVYTKN
APIVTTESKTVNETIHYVYTDGTTAHDDYVAQPITFTRTVFTDAVTGEKTYGGWSAAQQF
AAVDSPAIKGYTPDQSKISTQTVTGDSSDLEFTIVYTKNAPTVTTESKTVNETIHYVYTD
GTIAHDDYVAQPITFTRTVSTDAVTGEKTYGGWSAAQQFAAVDSPAIKGYTPDQSKISTQ
TVTGDSSDLEFTVVYKADSTSTKPVKPEQPTIPTTPTEPVKPGQLTTPAKPDQPMTSDKS
VQTITIKFVGQRLPQTNETDQQHMTLSGLLLLAMSGLLGLLGMAKRQHKE
Download sequence
Identical sequences F9UN23
YP_004889126.1.96219 220668.lp_1229 LpR55 gi|380032135|ref|YP_004889126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]