SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 220668.lp_1268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220668.lp_1268
Domain Number 1 Region: 12-175
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 5.3e-32
Family Lambda integrase-like, catalytic core 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 220668.lp_1268
Sequence length 186
Comment (Lactobacillus plantarum)
Sequence
MERMHYNVEPLRTDQEIDDFLWAVSQARYGERNRMIVLVGINTGLRMSDILRLKVGQVRG
KDRVMIMEQKTGKKRWLFLKNLKTELAHFTRYRGANEPLFCSGRGGALTVNGVYRVFQTA
GEYLERDDIGTHTLRKTFGYHYYQKTRDIAGLMMIFNHSSEQVTKRYIGIERDNLERQLW
DFKLGV
Download sequence
Identical sequences A0A1A0DLF2 A0A2J6TXL0 D7VC58 R9X255
220668.lp_1268 644042.JDM1_1073 APC20663 gi|308180215|ref|YP_003924343.1| gi|513840842|ref|YP_008120814.1| gi|254556240|ref|YP_003062657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]