SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 220668.lp_3001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220668.lp_3001
Domain Number 1 Region: 46-253
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-27
Family Clostridium neurotoxins, the second last domain 0.073
Further Details:      
 
Domain Number 2 Region: 434-455,483-729
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 6.15e-16
Family DeoB catalytic domain-like 0.052
Further Details:      
 
Domain Number 3 Region: 273-379
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0000184
Family Cellulose-binding domain family III 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 220668.lp_3001
Sequence length 1074
Comment (Lactobacillus plantarum)
Sequence
MIKPRVLTTLLVCSAILTTTVTPAVAAVTPMATPSEQVAEPVASPAVPTAILSLAIQNQQ
LVDLIGQTQWQTYGQPAVTKDPEFNDQVLNLDGKSAFYTTFTDQQFAKLQNGMAIEAYFK
YDPAADANGEHEIFSSQQGGGLGLGVQNNQVVFFAHDGSGYKTPKGTLHKGQWVHAVGVI
DKNKTASLYLDGQLVQQVAMPGDLKLAQGTKDFVLGGDAVPGSHVQSMMTGQIRQARLYD
QTLTSQQVSQLNVEAQVGKQPVAPVPVDQTIATKLVGPKRIASGHTYGLNVHARQIKATG
AAPITMDVVYDAAKFDYVGAERLLQGGKTQIQLIAPGRIRLTTTANLSKAEFKMYAQTRL
AHLNLKAKAAGETQIKFEQLTKDTTIELGPAQTVEIQGKYALDYNGDGIIGVGDVALANA
ADKVAAAKAAEIKPYKHVVVLTTDGGGNPWDPKGMYYAQGAEQGTKTPVWTTNPEIMKKR
RNTYTMDLFNKQFAMSTSARAVSPAISAQNYISMLHGRPWDTLPKEYQGTNATMGQEYFA
DFNKPQAMFPSVFKMLQADNPTRGAAAFSEWGPIVNSIIEPDAAVTTKQSASLKSFDDVA
NYIGTPEFQSTGLVYMQSDYMDGQGHGHGWYNDNYWDKYAQYDALFKRVMDKLEATGHIH
DTLVIANADHGGSGKNHGGWDEYNRSIFMALGGETVDNGRRLHGGSNADISALILNALQV
PQTPQMFDSQVFDSLAFLKQTDLSKKKRSVETLKLSRNDQEAKVQLTHNQNRQLTAFDLQ
LDLAGREVADVKVPTGVQILRQTVANGQLRLTVSASQPVTDLVTIELVPSKTRAAKTIML
SQAMAATADGTEVLVDLDNDNPLTSTAKPDENGSTTTKPDGNGTAVKPDENGSTTTKPDG
NGTAVKPDENGSTTTKPDGNGTAVKPDENGSNTTKPGGNGTTVKPDKNGSSTTKPNGNGT
AVKPDKHETSTTGSGTVNTSGADKTSTNDNGTSMTAGTASSHASTVTDRVTSGTVLPETS
SSAATNHGSHSTGHHGSGWLPQTGEAVQRWLAVAGGVFLMLTGAIAVWWRKRRA
Download sequence
Identical sequences F9USD0
gi|380033583|ref|YP_004890574.1| 220668.lp_3001 WP_011102000.1.57 YP_004890574.1.96219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]