SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 220668.lp_3450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220668.lp_3450
Domain Number 1 Region: 57-201,248-326
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.31e-18
Family Legume lectins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 220668.lp_3450
Sequence length 716
Comment (Lactobacillus plantarum)
Sequence
MWKGPKQILVALTALMGLWAGTAQIQAADEATLATAPSGLNQLDKLFTLPAAFSSGISNS
ANIGNVTNASSPNTQAVQVINGKKQMGGFWSNDANRLDLNKNATFKMWVYLGTSTSTSKA
GDGMAFVLQNDPNGTAASAQVSSSSIIGETLGVWGVDTDNKLKDGEEFAKTAIQNSWALE
FDTYTNTSTSYSNAGKGDSFDDGIKKQHIATGYPGLASQYENQSVRSLDVTGIIWSTRYY
FTQKHTNLVTNMSLGDSKWHHLVMDWHAATKTMTYTYNDINPDGSATGSGFTQSEVLDTS
QFNSSDGLVRWGFMGATGSNSGNNMVVIESAPNLVDVHAAVKVTDKTKNREIKTGGQLKA
QHKVQYDYQLTYQGGQIDWDNITAELNLPQHITFDSAKVTYADGSEQTLTAPTSSDTKVD
YTLDKAVSASQPTATITLNGTAENVVVNEQTTATTATFKNKVFETTTEAPDYMITVDQPL
YLKIRNSPYTVANGEDVIIRGIVAAEDSEQLTNGQVTLHPTLNGKEMPTVQMSDDDEQGY
FYYKVKAEDLHVGDDNEIELWASDRYENVSPVDKAQIIVTAGELGFKTVAKSSTFKTITL
DGSAQTTDREDDWQLVVRDSRGKGSSWQLQASATNFKTTGGQNLAGDVIFRDGEQTTTLN
SAGTVIDSHTATSDNDDYDVLADWTNKSGILYQSNAGATPGSYTGDITWTLTDAPK
Download sequence
Identical sequences F9UUC3
gi|380033948|ref|YP_004890939.1| WP_011102168.1.57 YP_004890939.1.96219 220668.lp_3450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]