SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 221109.OB3159 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  221109.OB3159
Domain Number 1 Region: 2-232
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.21e-78
Family Sir2 family of transcriptional regulators 0.00000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 221109.OB3159
Sequence length 236
Comment (Oceanobacillus iheyensis)
Sequence
MIKDWLQESNYTVIFTGAGMSTESGLPDFRSANTGLWKQHDPSKIASIDTLNNNVETFID
FYRERVLKVKEYGPHQGHYILAEWEKQGLVHSIVTQNVDGFHQASGSKIVHELHGTLQKL
HCQSCGKEYSSKEYVENEYHCDCGGVLRPSIILFGEMLPQEAFQTAFNDAEKADLFVVLG
SSLTVSPANQIPLIAKENGAKLVIVNQDPTPYDQYADMTISDQKIGEFLRSISNEG
Download sequence
Identical sequences Q8ELR0
gi|23100614|ref|NP_694081.1| 221109.OB3159 WP_011067556.1.3139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]