SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 221988.MS0247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  221988.MS0247
Domain Number 1 Region: 4-70
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.36e-17
Family Short-chain ferredoxins 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 221988.MS0247
Sequence length 86
Comment (Mannheimia succiniciproducens MBEL55E)
Sequence
MALLITDKCTNCDMCLPECPNEAISVGDEIYLIDPALCTECVGHYDTPTCQKVCPINKCI
ITDPDHIETQDQLWERFVLIHHADQV
Download sequence
Identical sequences Q65W06
221988.MS0247 WP_011199429.1.101358 WP_011199429.1.33615 gi|52424302|ref|YP_087439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]