SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 221988.MS0493 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  221988.MS0493
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.77e-49
Family Ribonuclease PH domain 1-like 0.0000115
Further Details:      
 
Domain Number 2 Region: 295-467
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-45
Family Ribonuclease PH domain 1-like 0.0000181
Further Details:      
 
Domain Number 3 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.14e-30
Family Ribonuclease PH domain 2-like 0.00086
Further Details:      
 
Domain Number 4 Region: 452-559
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.03e-28
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 5 Region: 553-638
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.4e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 6 Region: 619-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.15e-21
Family Cold shock DNA-binding domain-like 0.0000827
Further Details:      
 
Domain Number 7 Region: 238-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.54e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 221988.MS0493
Sequence length 704
Comment (Mannheimia succiniciproducens MBEL55E)
Sequence
MNPIVKQFKYGQHTVTLETGAIARQATAAVMASMDDTTVFVSVVAKKDVKEGQDFFPLTV
DYQERTYAAGKIPGGFFKREGRPSEGETLIARLIDRPIRPLFPEGFLNEIQIIATVVSVN
PQISPDLVAMIGASAALSLSGVPFNGPIGAARVGFINDQFVLNPTMAEQKQSRLDLVVAG
TDKAVLMVESEADILTEEQMLAAVVFGHQQQQVVVEAIKEFVAEAGKPRWDWVAPEPDSA
LISKVKAIAENRLGDAYRITEKQVRYEQIDAIKADVIAQITAEDEEVSEGKIVDIFTALE
SQIVRGRIIAGEPRIDGRTVDTVRALDICTGVLPRTHGSAIFTRGETQSLAVVTLGTERD
AQILDELTGERQDTFLFHYNFPPYSVGETGRVGSPKRREIGHGRLAKRGVAAVMPSISEF
PYVVRVVSEITESNGSSSMASVCGASLALMDAGVPVKSAVAGIAMGLVKEDDKFVVLSDI
LGDEDHLGDMDFKVAGTRTGVTALQMDIKIEGITPEIMQIALNQAKSARMHILGVMEQAI
SAPRAEISEFAPRIYTMKIDPKKIKDVIGKGGATIRALTEETGTSIDIDDDGTVKIAAVD
GNAVKTVMARIEDITAEVEAGAVYTGKVTRLADFGAFVAIVGNKEGLVHISQIAEERVEK
VSDYLQVGQEVQVKVVEIDRQGRIRLTMRDLGSKEESQELSVEQ
Download sequence
Identical sequences Q65VB0
WP_011199672.1.101358 gi|52424548|ref|YP_087685.1| 221988.MS0493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]