SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 221988.MS0909 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  221988.MS0909
Domain Number 1 Region: 49-360
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 5.81e-81
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000279
Further Details:      
 
Domain Number 2 Region: 363-482
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-19
Family Glycosyl hydrolases family 32 C-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 221988.MS0909
Sequence length 502
Comment (Mannheimia succiniciproducens MBEL55E)
Sequence
MRSFLPHFSLFYFHQGIMMIIFNNGKYKSILAAEQGELERIKSEVEKDRDFRPYYHLAPS
TGLLNDPNGLVFDGEKFHLFYQWFPFDAIHGMKHWKHFTTEDFHIYTEADPLIPCELFES
HGCYSGGALPVGDKIAAFYTGNTRRAADNQRVPFQNLAIFDRTGKLLSKRPLIENAPKGY
TEHVRDPKPYFTKEGKIRFICGAQREDLTGTAIIFEMDNLDDEPRLLGELSLPAFDNQKV
FMWECPDLLKVGDNDIFIWSPQGKRREARRFQNNFHAVYAVGKLDDRTFNAAHIAELDQG
FDFYAPQTFAGLENQKHAVMFGWCGMPDLTYPTDKYKWHSMLTLPREITLQGNRLVQRPI
KEIYQNLTALSQISLQQQAEIQDLDRAYIKFDAENTAFNIRFFANEQGQTLSLSYDGELV
CLDRSQTEETEWMKKFASQRYCEIKNLRQVEIFFDRSIIEIFLNDGEKALTSRFFIANRQ
NSVKTDRTLRLNVGYPKEIEYK
Download sequence
Identical sequences Q65U44
gi|52424964|ref|YP_088101.1| 221988.MS0909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]