SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222523.BCE_0906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222523.BCE_0906
Domain Number 1 Region: 47-310
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.35e-37
Family GpdQ-like 0.0043
Further Details:      
 
Domain Number 2 Region: 452-654
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.07e-27
Family Trypanosoma sialidase, C-terminal domain 0.043
Further Details:      
 
Domain Number 3 Region: 345-443
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000128
Family Fibronectin type III 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 222523.BCE_0906
Sequence length 819
Comment (Bacillus cereus ATCC 10987)
Sequence
MERTALRKVKGLIGLLMVFVLAFVSFPWSTSVKAEEKKQEKAPSEKKIVFPVVSDVHIKN
SGTDDTFRWKRAIEQLNTLAPKQDAFVIVGDFTDSGSVQQYDRFMQVYNENANKDAVRMN
SLGNHDYWNGLSVEGAQKRFLEKTGMESIYYHKVVKGYHFLVMSPEDGTTHGYYSDKQIN
WLKEEMAKAQKDDPEKPIFVFLHQHIKDTVYGSQEWGTKDSAKINEVLKAYPQVITFSGH
SHYPLDDPRSIHQKDFTSVGTSSVSYMEVEGGKVQGNIPPGASTLSQGLLVEVDDKEVTI
NRRDFHTNSWTGEPWKIKLPAKKETFTHVEDRDKEKPYFAKDAKIAVSNVTENAATVTFP
QALDNLLVHSYRVQARDKQTGEIKNKLLAFSEFYRDPVPKELTFTLAGLDGGKTYTLEVV
AIDSFGNESVQPLTAEITTKKDNIDPNVKVPKADVFDVNFADGTFKDNSPFGTKGDVKGN
VTIEYDKALKKNVMKLNGKANTFGYLPFSAAQKEKVVNTFTLETVFAMNEIRGQGILQNT
ESGGIGFESTGSGYVELWAHIGGSYKRVGVQLEANKTYHLTGTYNGSEVAIYVDGKKVNS
QPATGKVYHPNVPFALGADPDSNGNGGIPLNGQIALAKLYSKALSSSEVLAAYNEFSNRT
KLEQVNALFEELGKVKEVLAGTYEFGDKPGQYSKEAFQELEKSYNNAKQVFENVASTGEQ
IVQAYNELKTANQTFIQSKVVEQPKTLKEKLQMNIESAKAVVKKAQAANVTDGSVKSLSQ
KITVAESVLKDAKVKDAQVETMNRTLEYAISLVEKSINK
Download sequence
Identical sequences A0A150EID7 A0A1J9Y6L2 Q73D08
WP_000442462.1.79043 gi|42779982|ref|NP_977229.1| 222523.BCE_0906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]