SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222523.BCE_2473 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222523.BCE_2473
Domain Number 1 Region: 33-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-28
Family Beta-D-xylosidase C-terminal domain-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 222523.BCE_2473
Sequence length 198
Comment (Bacillus cereus ATCC 10987)
Sequence
MKISHIPEHIEQLTIMNVPEYYKLNNNHALIVRSKAETDFWLKTHYGFEVMNGHVFYTET
MTDFQAEVQLRMNPNSKFDQAGLFVMVSEKCWLKTSLEYIPDGPSHLGAVVTNNGYSDWS
TQDFPTELANEQLRFRIVRKRGDYTIYVKKIHQWEQIRIAHLMEDIGDKPIKIGFYTCSP
SKNNGFETEFLDFTTEKI
Download sequence
Identical sequences A0A151UQ50 A0A1J9YGL5 Q738C2
WP_000703152.1.24759 WP_000703152.1.39001 WP_000703152.1.45089 WP_000703152.1.49802 WP_000703152.1.50770 WP_000703152.1.51656 WP_000703152.1.59052 WP_000703152.1.61944 WP_000703152.1.65758 WP_000703152.1.77902 WP_000703152.1.79043 WP_000703152.1.92347 WP_000703152.1.97617 222523.BCE_2473 gi|42781535|ref|NP_978782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]