SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222523.BCE_3023 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222523.BCE_3023
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.74e-17
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 222523.BCE_3023
Sequence length 233
Comment (Bacillus cereus ATCC 10987)
Sequence
MESFSFIINEKHKKLVQTILNEYVFRDKVNGLMLIGSVARGDAYPDSDLDFYILLQEGQK
KKFHSEMREDILVEYKSADFNQIQINFKNNPMELYSFLEGKTLFDKSGELKKLKEIATYE
FENYRVSSDKMKGISHWLHSSLIKIQSALKANDELKASYIVQTSTWTLLDGIWAVNNKPI
PPAGSVLKYIETLSKVPTHFEGFINKLFLGDTTERTSAAIFLIEWVLHNLKNK
Download sequence
Identical sequences Q735X8
gi|42782079|ref|NP_979326.1| 222523.BCE_3023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]