SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222523.BCE_4404 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222523.BCE_4404
Domain Number 1 Region: 9-210
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.25e-29
Family Extended AAA-ATPase domain 0.013
Further Details:      
 
Domain Number 2 Region: 214-333
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 1.07e-26
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 222523.BCE_4404
Sequence length 336
Comment (Bacillus cereus ATCC 10987)
Sequence
MSDIHKKIKKKQFAPLYLLYGTEAFFINETIKLITTEALEEEDREFNVVTYDLEEAYLED
VVEDARTLPFFGERKVLLIKSPLFLTSQKEKLEQNIKILEEYIGEPSPFSILVFVAPYEK
LDERKKITKLLKKTADVVEANAMQVQDVQKWIVARADEVHVHIDHAAVSLLLELVGSNVT
MLAKEMDKLTLYVGMGGDITPKLVAELVPKSVEQNVFALTEKVVKKDIAGAMQILDGLFT
QQEEPIKLLALLVSQFRLLHQVKELQQRGYGQNQIASHIGVHPYRVKLAMNQTKFFSFEE
LKKVIMELAEADYSMKTGKMDKKLVLEFFLMRLNHM
Download sequence
Identical sequences A0A0F5RRW4 A0A150E7G9 A0A1J9YQI2 F0PX87 Q730L2
gi|42783450|ref|NP_980697.1| WP_001279918.1.100241 WP_001279918.1.101550 WP_001279918.1.11060 WP_001279918.1.1850 WP_001279918.1.21172 WP_001279918.1.23110 WP_001279918.1.24759 WP_001279918.1.25757 WP_001279918.1.35255 WP_001279918.1.39001 WP_001279918.1.42165 WP_001279918.1.45089 WP_001279918.1.49802 WP_001279918.1.61944 WP_001279918.1.64706 WP_001279918.1.69970 WP_001279918.1.71648 WP_001279918.1.77370 WP_001279918.1.77902 WP_001279918.1.79043 WP_001279918.1.79687 WP_001279918.1.80239 WP_001279918.1.80571 WP_001279918.1.80964 WP_001279918.1.90671 WP_001279918.1.91569 WP_001279918.1.92347 WP_001279918.1.96356 222523.BCE_4404 gi|384182143|ref|YP_005567905.1| 378740 gi|402555542|ref|YP_006596813.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]