SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222523.BCE_4717 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222523.BCE_4717
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.44e-42
Family N-terminal domain of MutM-like DNA repair proteins 0.0000148
Further Details:      
 
Domain Number 2 Region: 134-223
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.3e-29
Family Middle domain of MutM-like DNA repair proteins 0.0004
Further Details:      
 
Domain Number 3 Region: 222-274
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.49e-17
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 222523.BCE_4717
Sequence length 276
Comment (Bacillus cereus ATCC 10987)
Sequence
MPELPEVENVRRTLENLVTGKTIEDVIVTYPKIVKRPDDAKIFKEMLKGETIENIKRRGK
FLLLYVTNYVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLF
KKGEEMNQMPLADLGPEPFDAELTPQYLQERLQKTNRKIKVVLLDQRLLVGLGNIYVDEV
LFRSQIHPEREASSLTAEEIERIYEATVTTLGEAVKRGGSTIRTYINSQGQIGSFQELLN
VYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPRI
Download sequence
Identical sequences A0A151UV66 A0A1J9YIS4 Q72ZF1
222523.BCE_4717 gi|402555288|ref|YP_006596559.1| WP_001114498.1.101550 WP_001114498.1.11060 WP_001114498.1.19173 WP_001114498.1.23200 WP_001114498.1.24759 WP_001114498.1.39001 WP_001114498.1.45089 WP_001114498.1.49802 WP_001114498.1.64706 WP_001114498.1.65758 WP_001114498.1.65983 WP_001114498.1.77902 WP_001114498.1.79043 WP_001114498.1.80571 WP_001114498.1.86082 WP_001114498.1.90671 WP_001114498.1.92347 gi|42783763|ref|NP_981010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]