SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222523.BCE_5161 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  222523.BCE_5161
Domain Number - Region: 85-123
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00691
Family FCH domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 222523.BCE_5161
Sequence length 260
Comment (Bacillus cereus ATCC 10987)
Sequence
MLKSYRTALVSLSLLLVFVLSGCSNAAPIDAHSTGIWDHYFVYPISFMIQFVAHHIPGAS
FGIAIIIMTLVIRSAMIPLAVSQYRSQAKMKKMQPELQKLKKKYGDVSKDLEKQKQYQKE
MSELMKSGGWNPLAGCWPIFIQMPIFSALYYAISRTEEIRTSSFLWVNLGHADPYHILPI
IAALTTFIQMKVFQSNITAGEQVQMLKMQQIMMPAMILFMGFAAPSGLVLYWITGNLFTM
TQTIVLRRIMEREELQLQKA
Download sequence
Identical sequences A0A136C2X4 A0A1J9Y9I5 Q72Y60
gi|402554864|ref|YP_006596135.1| WP_000920550.1.19173 WP_000920550.1.23200 WP_000920550.1.24759 WP_000920550.1.39001 WP_000920550.1.45089 WP_000920550.1.49802 WP_000920550.1.50770 WP_000920550.1.51656 WP_000920550.1.61944 WP_000920550.1.65758 WP_000920550.1.65983 WP_000920550.1.77902 WP_000920550.1.79043 WP_000920550.1.80571 WP_000920550.1.86082 WP_000920550.1.92347 222523.BCE_5161 gi|42784207|ref|NP_981454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]