SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5NZN0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5NZN0
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.84e-18
Family alpha-D-mannose-specific plant lectins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 222929.C5NZN0
Sequence length 114
Comment (Coccidioides posadasii)
Sequence
MSHSTLGNGEWLLKGNSLFSEDRSVEFKMQEDGKIAVYWGGQCRFQNTSHQSYNMKGIKM
EKDGVLRMYDDNDKVVWETKLEGAGDSTVICAVQNDGNVVLYRGTPIWASHTQK
Download sequence
Identical sequences A0A0J6FQQ3 C5NZN0 E9D301
CPAT_07698 222929.C5NZN0 CPSG_04542T0 XP_003072068.1.1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]