SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5P0H9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5P0H9
Domain Number 1 Region: 567-653
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000124
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 
Domain Number 2 Region: 638-724
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 3 Region: 268-364
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000438
Family Eukaryotic type KH-domain (KH-domain type I) 0.0083
Further Details:      
 
Weak hits

Sequence:  222929.C5P0H9
Domain Number - Region: 481-548
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000281
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 
Domain Number - Region: 380-428
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.097
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P0H9
Sequence length 991
Comment (Coccidioides posadasii)
Sequence
MHKISNFTGQARHGWERMTPAFGMSRPQHDLAGSHPFRRPVPPAIPSPPKNDAIINLSFN
VPFSSNLSGPDPDDVLHSTPGALQRWTYPAGTPEGTPTHKLPVHANHIDSLRKLCRQISE
NSSGRIEATVTSSEPKALASLQLRPQGLVTNVCISGETDLVYQMRAKIFKETPFALRCAT
VDIDVNLVMDSNSNAIKQNVLNHLNTLASYTGVDIFLLSPKIVDADSAIVSSYGYSTENG
IDNRFRIAIYGDVESVEHAKTRVLIMIDQILKRQVDVMKLELTMHTLVCGRTRRNIKLIE
AATDTAIYFPPSFPNVYGYTPPGAYRRADDELYITGTSQEQIGKAKQKLHELVRGVKVYV
KDVSVTPTKIDSILLDRLDKVRKVMEANGCYVLFPQLGSQHNTIRVQGTEILQVERTIRE
LMALAGQFYGATWWIILPDNAPQMRVPSPSDIRTMLSDICANSGADVSFDKLTFTIHGSD
DAVKAAMMVIHHIPFVKRSPHQMRVKIELANEHKEFVSGKKNGKINKIMGQSNVQIIFDG
FNEYNFYIDVCASQYEAARNGLDLVEQEMPASISFHVPDQYHKRIIGIGGQHIQRIMKKY
SVFVKFSNAMDRGGVNKDDDDIRVENVICRTPARNAQNLELVKQEIMDMVEKVDAEFVSE
TVLVNRLYHRELIARMKEIDELEKKWNCKIDFPSTETASDFVTISGPEYQVPQAVDAFLG
MVPETHEISFQGSEELREFFKTTEFATEVRKKLKEQYEVDVTVEATGEQPSSEANSPPPE
DRLVLGYTRNNAGGLKDAIDFLVSRLVSHGLDATTVKGSIPRPKSDSFEESLPFFDSKLL
QHAPAPLVTDSPTRPNFSDDASDRGSIFERLRKPGSISSFSSFIGRKNHSGSPGSFFKHA
SSNASKASLVSMESRDSGYRNPWNDSGVNLPEEDVFNASSAWPSRFDSAFPFGTAPGDMT
PRHDLRASFDSGRPSTSNSTSGYPAPIGPPR
Download sequence
Identical sequences C5P0H9 E9DFL9
XP_003071332.1.1890 222929.C5P0H9 CPSG_08534T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]