SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5P1N5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5P1N5
Domain Number 1 Region: 1058-1192,1224-1428
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-59
Family p120GAP domain-like 0.0041
Further Details:      
 
Domain Number 2 Region: 258-415
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.5e-38
Family Calponin-homology domain, CH-domain 0.0000187
Further Details:      
 
Domain Number 3 Region: 1647-1746
Classification Level Classification E-value
Superfamily RGC domain-like 3.66e-30
Family RGC domain 0.001
Further Details:      
 
Weak hits

Sequence:  222929.C5P1N5
Domain Number - Region: 688-740,775-795
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0796
Family Motor proteins 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P1N5
Sequence length 1747
Comment (Coccidioides posadasii)
Sequence
MSYNLSLKPTRSDLSTQSAGPLRHDSTASTNSSAYSIYSNSFTPSRTSTLTSHISSTYRP
GTPEHKVDRGSRVLNGRREFDGKSSPGEAYENIRRSLRPLKQAPNGTPPKIKGSCHTRSQ
TVIDLIPQHDIVRKEPGYDAYRSEENKPPQDENHRRVSYHARTRSTPNHSSFTAALTAPE
LQSLGRSSTRHLRTLSKFAQSEDDEFSITSPVPSVVGLQGRRQLKRTDSVCGSRTAAVAK
TSGAALWSQRDWMDKQRQFLQAYEYLCHIGEAKEWIEDVIEKPIAPIVQLEEALRDGVTL
AEVVQALYPHRIFRIFRHPKLQFRHSDNIALFFQFLDEVELPEVFRFELIDLYEKKNIPK
VIHCIHALSWLLFKQGVIDFRIGNLVGQLEFEHHELEQTQRGLDKAGVPMPSFSGMGASF
GAEPEPEPEPEPVETEKERIDRELRENEGSISDFQAQMKGALLRLKLGNLMQHLWDNEEM
LIDLQSRIRGDWTRQIMDYRLSMRQFAVDLQAITRGFLIRRTWQDRQIGCATAEPEILKL
QSLIRAKRARSEVQILRVRAKKEEPGIKLFQAAIRGALARKVAYDQYEETREAESEVLFL
QAAFRGMMTRRAILQDTTDLKMQAVQSTELLQAAVRGMMQRRALQQGISDLEMEAGLYIQ
GLQASIRGMLKRRALQQDALDLKNDAEQSVQFLQATIRGMLARYALSQDGSRLQRETGAI
ITVQAAARGFTARRRKLDLERALENMADTWIALQSAARGSALRKDLEELRAKLRDQTPSI
IEIQAAVRGSALRKIFSTTISELRECEETVTSFQALGRAFLLRSRLDQVCRDLFAETSVI
THLQALSRAAIVRIDIGNLLIELDENTDEIVQLQALSRAMLLRLDVGNALADLEAEEEVI
TDFQSFIRGFLVRRRFAEKQRFYRENMDKVIKVQSFVRGKIQGEAYKSLTSGKNPPVGTI
KGFVHLLNDSDFDFDEEIEFERLRKTVVQQVRQNEMADQYITQLDIKIALLVKNKITLDE
VVRHQKHFGGHVGAVLPNADLSSKDPFDLKALNKTSRKKLEYYQELFFILQTQPQYLAKL
FRRLRELATPERENERIKHLIMGLFGYAQKRREEYYLLKLLVICIKEETDICTSVQDYLR
CSSFWAKLFGAYTKSPRDRKYMKDLLGQVVKENIIDNPELDLESDPIQIYRSAINNEELR
TGRRSRRPPDVPREQAIKDPETRATFIRNLQDLRDIADQVFTSLEELLHRMPFGVRFVAK
KMYECLLAKFEGEDQGYLLQITGQWVWKNYLQPAMMEPEKSGIVNHALTQEQKRSLGEIS
RVMAQVASGRLFGNDNVYLQPLNAYIGESIQRLGSVWGNLITVQDAEAHFEIDEYNDLYA
KTKPTLYIKMSDIFSIHQLVAAEISYICGQDDTLREIIRDLGSVKSNESELMSVSSSEIS
LTLTPKLHNVEDPDAEVKALLMETKRCILYIIRVQSGANLMEILVKPPTLEDEERWETLV
QEEFSHNSQKRAAYSDANTLVDIGSMSYPELKRTALENIVRLEQAGRITRHNHYQDLLNE
IALDIRTKHRRRIQRQRELEGVRLTLERLNDQAVYLEQQLKTYNDYIEQAMITLQNKKGK
KRFLMPFTKQWDHERELQRSGRVLKFGSYKYSARNLADRGVLVHWKGYTERQWDRVDLTI
SSNEVGVFMIDGSSGNMMIPGANAQVPLDDLLQAQFNNTQFMDFFEGQLRVNVNLFLHLI
MKKFYNE
Download sequence
Identical sequences C5P1N5
222929.C5P1N5 XP_003071738.1.1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]