SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5P276 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5P276
Domain Number 1 Region: 9-115
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000471
Family Tetramerization domain of potassium channels 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P276
Sequence length 221
Comment (Coccidioides posadasii)
Sequence
METEAHSPSERVVLRVGESQYFTTVGTLVEKSQYFKSYFSGAWPIEKEEDGSIFIEGDPH
AFDYVMQYLRRGTFPLAFDVQRGHNYSMYSRVLEEAKYFQCPLLVAWLEDACYNKCVTWR
VKTTIQEATELASSGNGSTRDPKFSPYSKCAEKVYECPRGILGHRGGEACGRKCRKAQGN
DPREFDTESTIEKWIVARTEYLPHLGWMTDSGYFSHSSLST
Download sequence
Identical sequences C5P276
XP_003071124.1.1890 222929.C5P276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]