SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5P4Q9 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5P4Q9
Domain Number 1 Region: 91-160,195-320
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-35
Family Glycosyl hydrolases family 16 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P4Q9
Sequence length 326
Comment (Coccidioides posadasii)
Sequence
MVSIFLLFVSALLWHEAVAVYELVDNYAGNTFFSNFTFFTEPDPTQGFVKYIGEPEARKN
GLIGFSSSYSGDNMAWMSVDRTNVAPMGRESVRITSKKVYNQGLFIVDIAHVPTTTCGTW
PAFWMYGPDWPHGGEIDIYEGVNLEYQNSMTLHTGPGCTVSRHAESTGRMTTTNCDVAAA
GQKPNEGCKVRSQDPLSFGAGLNAVAGGMYATEWTVDAIKIWFFPRTFQIPYDITQGTPD
PNTWGLPTAHFAGNCSFTNSFKDLRIVINTTFCGQWAGQVWGKSPCASVTSTCEEFVANY
PEAFLQSYWAINSIKVYEKKPGWESA
Download sequence
Identical sequences C5P4Q9
XP_003069844.1.1890 222929.C5P4Q9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]