SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5P8G4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5P8G4
Domain Number 1 Region: 5-161
Classification Level Classification E-value
Superfamily SNARE-like 2.29e-19
Family Sedlin (SEDL) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P8G4
Sequence length 170
Comment (Coccidioides posadasii)
Sequence
MGTPSIASIGIIGKSDNLLHISVFPPHESAQVEFSLAFNSSLDVLELRQHDTSVDQDFGL
LHALDERFSVYGWLTNTGVKFLIIVDLEGRVAVPGKFAPLAGLRESDLKPAFRALQTAYM
KLLQNPFYDPDRNDTDCGEPATSNIGIKNHHFIAEVNRIGELWVPGMVNV
Download sequence
Identical sequences A0A0J6FVW4 C5P8G4 E9D0I8
CPAT_09944 222929.C5P8G4 XP_003068171.1.1890 CPSG_03017T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]