SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5P8G5 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5P8G5
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.64e-20
Family Canonical RBD 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P8G5
Sequence length 202
Comment (Coccidioides posadasii)
Sequence
MSRSGTTLYVTGFGHGTRARELAYEFERYGRLVRCDIPAPRTAASRLFAFVEYESRRDAD
DAYHEMHNKRIGRDDVLKIEWARTPPSASWRFDSGRDRRRDRTPPRRVRSPSPRRGRGDY
SPRKEDRRDRDYDRRDRDRSRSPDDRDRERDRDRERDRERDRDLRDDRDRRDEDRENGTN
GDDRKVPLDSPTPAHDELDTAE
Download sequence
Identical sequences A0A0J6FWJ3 A0A0J6YMY4 A0A0J8RE12 C5P8G5 E9D0I9 J3KD34
CIST_09678 CIRT_08200 CIMG_04239T0 XP_001244798.1.59393 XP_003068172.1.1890 CPAT_09943 222929.C5P8G5 CPSG_03018T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]