SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5P9H4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5P9H4
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.89e-38
Family Calponin-homology domain, CH-domain 0.000025
Further Details:      
 
Domain Number 2 Region: 162-229
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 2.48e-16
Family EB1 dimerisation domain-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P9H4
Sequence length 244
Comment (Coccidioides posadasii)
Sequence
MSESRQELLAWLNNLLQLNITKVEQCGTGAAYCQVYDSIFMDVPMSRVKFNVNTEYAYIQ
NFKVLQNTFTRHQIDRPVPVEALVKCRMQDNLEFLQFTKRFWDQNYPGGDYDAVGRRKAS
GAPLASSTSRPGTTSATGARRGATPTTAARPRVGGGVSANTAALTQEINSQKEAIAGLEK
ERDFYFAKLRDIELLLQQAVEADPELEKDEDSLIKHIQAILYSTEEGFEIPADAEAVGEE
LETF
Download sequence
Identical sequences A0A0E1RWS8 A0A0J7BD24 A0A0J8UD36 C5P9H4
XP_001244305.1.59393 XP_003068531.1.1890 222929.C5P9H4 CIHT_02973 CIMG_03746T0 CIRT_07668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]