SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5PAU2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5PAU2
Domain Number 1 Region: 92-157,203-441
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-63
Family Glycosyl hydrolases family 16 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 222929.C5PAU2
Sequence length 445
Comment (Coccidioides posadasii)
Sequence
MEKPARAPRNPFSDSAAASLRAASYSSQPSDIPSGSRQAARRQFKSYRLNGQYERPWLND
RKLKKTRVGNYIIWGFVVAGLALSAYINFSVSQKVARHEYCLILDDQFSSLNRDVWNHEV
QIGGFGTGAFDWTTTDERNSFVDSEGLHIVPTLTTETTSITEAQLIDGYTLNLTRAGGDG
SCTANTNEACSIRSNKTLGLIIPPVRSARLNTKGKKSIRYGRVEVVAKMPQGDWLWPAIW
MMPVNETYGTWPASGEIDIAESRGNDVDYSLGGRDVVSGSIHWGPTPETDAFWRSTRGKS
IRRTDYTKGFHTFGLEWSRDYMFTYVDSPLQQVLYWKFNKDQTMWQRGEFEGVTVNSSLL
MDPWSQTGNSNTPFDQPFYLILNVAVGSTNGWFSDGLGRKPWTDEGLAASDFYKSLDTFY
PTWPEDNDRGMTVKSVRMWQEGPCS
Download sequence
Identical sequences C5PAU2 E9DJ79
XP_003067871.1.1890 222929.C5PAU2 CPSG_09878T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]