SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5PEA4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5PEA4
Domain Number 1 Region: 160-254
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.08e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 222929.C5PEA4
Sequence length 255
Comment (Coccidioides posadasii)
Sequence
MPAPTSRLRVPEEIGKNAAASAPQINQNEDDVLIDSSAPLPEITTTSQDADTEMHVDEEG
RPLFTPIKATDGAYRIENRKVPVPPHRMSPLKAAWPKIYPPLVEHLKLQVRMNIKSKAVE
LRTSKHTTDTGALQKGEDFIKAFTLGFDVDDAIALLRLDDLYIETFEIKDVKTLNGEHLG
RAIGRIAGKDGKTKFAIENASRTRVVLADQKIHILGGFRNIRIAREAIVSLILGSPPGKV
YGNLRTVASRMKERF
Download sequence
Identical sequences C5PEA4 E9DG35
CPSG_08784T0 222929.C5PEA4 XP_003066877.1.1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]