SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5PEY1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5PEY1
Domain Number 1 Region: 275-355
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.41e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00072
Further Details:      
 
Domain Number 2 Region: 129-214
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.41e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 3 Region: 42-115
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000471
Family Eukaryotic type KH-domain (KH-domain type I) 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 222929.C5PEY1
Sequence length 366
Comment (Coccidioides posadasii)
Sequence
MSATEQQQATGAPGHEEGLSESFNRVNLSEQGEDITPKTEEEYAQSMLTLRAIVSTKEAG
VIIGKAGKNVADLRDETGVKAGVSKVVQGVHDRVLTVTGPLQGTAKAYGMVAKSLLEGAP
QMGMGGIIQNNGTHPVRLLISHNQMGTIIGRNGLKIKCIQDASGVRMVAQKEMLPQSTER
IVEVQGTPEGIEKAVWEIGKCLIDDWQRGTGTVLYNPAVRANVGGASMNSAFVGPNPNTY
SGRPYNRTGNGADFSDHPGTYNRRHNSDAPNRGIPLVTEDGEEVQTQNISIPSDMVGCII
GRGGSKISEIRRSSGARISIAKAAHDETGERMFTIMGSAQANEKALYLLYENLEAEKMRR
SQQPQE
Download sequence
Identical sequences A0A0J6Y033 C5PEY1 J3KKB7
CIMG_01955T0 222929.C5PEY1 CIRT_02108 XP_001248184.1.59393 XP_003065344.1.1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]