SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 222929.C5PGC1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5PGC1
Domain Number 1 Region: 131-211
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.16e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 2 Region: 240-316
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.33e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00058
Further Details:      
 
Domain Number 3 Region: 349-415
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000395
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 222929.C5PGC1
Sequence length 508
Comment (Coccidioides posadasii)
Sequence
MRLPKLAVSQRRKALRTVQITVFTLRPPTPPHSLLVLIPVYSDQRGADPRRDSRSYHRSR
SPSRTPPRATRDVFRDNYNPYRDERRGDRRGNDRAYVRERSFSPRPAGRATDAYPAQPSR
PHRGASDRSPPSRRGGGMDDSTETINIDSKLVGLIIGRQGDNLRRIESDTGTRIQFLDSP
ESNVNIRPCRISGTRAARSDAKAEIFRMISENNAARGAMASADRFASRGPHEPPGRQPGY
GEDENSSTQMMVPDRTVGLIIGRGGETIKDLQDRSGCHVIIAPEDKSLNGLRPVNLNGAP
RAIQRAKDLILEVVETDSRQGGAPPQREPRGYAPERDTGGPAPERGDDSIFIPKESVGMI
IGKGGDTIKELQNITGCKVNILPAVGREVDREVVMIGSKQAIEQMKKSILEKVDTFKSRS
QARRDDGYSERYSQPQLRSYPQDQTKSSQPSQASAPAAGGDSADPYAMYGGYENYVAMWY
AAMAQQQQQQQQPYQQQSPSDPKPPGVP
Download sequence
Identical sequences C5PGC1
XP_003065719.1.1890 222929.C5PGC1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]